NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS13927.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13927.1 Public Homo sapiens 22 MYH9 22 109 92 CCDS HistoryNCBI Gene:4627Re-query CCDS DB by CCDS ID:13927.1Re-query CCDS DB by GeneID:4627See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13927.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000216181.10 ENSP00000216181.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000216181.10Link to Ensembl Protein Viewer:ENSP00000216181.5Re-query CCDS DB by Nucleotide ID:ENST00000216181Re-query CCDS DB by Protein ID:ENSP00000216181
Original member Current member NCBI NM_002473.5 NP_002464.1 Accepted alive Link to Nucleotide Sequence:NM_002473.5Link to Protein Sequence:NP_002464.1Re-query CCDS DB by Nucleotide ID:NM_002473Re-query CCDS DB by Protein ID:NP_002464Link to BLAST:NP_002464.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002464.1 1960 P35579-1 1960 100% 0 0

Chromosomal Locations for CCDS 13927.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 36282668 36282785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36284093 36284265 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36284403 36284511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36285121 36285329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36285658 36285781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36285865 36285953 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36286718 36286846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36288252 36288413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36288727 36288939 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36289085 36289297 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36291986 36292234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36293329 36293481 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36293759 36293863 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36294092 36294298 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36294932 36295076 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36295505 36295717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36296843 36297014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36298919 36299042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36300127 36300264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36300851 36301057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36301534 36301665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36302568 36302676 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36303995 36304155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36305033 36305102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36305930 36306051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36306414 36306607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36309282 36309396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36312049 36312222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36314145 36314318 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36316517 36316669 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36318207 36318325 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36319540 36319635 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36320220 36320363 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36320798 36320896 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36321758 36321821 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36322429 36322521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36326568 36326661 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36327461 36327488 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36341370 36341526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 36348904 36349236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5883 nt):
ATGGCACAGCAAGCTGCCGATAAGTATCTCTATGTGGATAAAAACTTCATCAACAATCCGCTGGCCCAGG
CC
GACTGGGCTGCCAAGAAGCTGGTATGGGTGCCTTCCGACAAGAGTGGCTTTGAGCCAGCCAGCCTCAA
G
GAGGAGGTGGGCGAAGAGGCCATCGTGGAGCTGGTGGAGAATGGGAAGAAGGTGAAGGTGAACAAGGAT
GAC
ATCCAGAAGATGAACCCGCCCAAGTTCTCCAAGGTGGAGGACATGGCAGAGCTCACGTGCCTCAACG
AA
GCCTCGGTGCTGCACAACCTCAAGGAGCGTTACTACTCAGGGCTCATCTACACCTATTCAGGCCTGTT
C
TGTGTGGTCATCAATCCTTACAAGAACCTGCCCATCTACTCTGAAGAGATTGTGGAAATGTACAAGGGC
AAG
AAGAGGCACGAGATGCCCCCTCACATCTATGCCATCACAGACACCGCCTACAGGAGTATGATGCAAG
AC
CGAGAAGATCAATCCATCTTGTGCACTGGTGAATCTGGAGCTGGCAAGACGGAGAACACCAAGAAGGT
C
ATCCAGTATCTGGCGTACGTGGCGTCCTCGCACAAGAGCAAGAAGGACCAGGGCGAGCTGGAGCGGCAG
CTG
CTGCAGGCCAACCCCATCCTGGAGGCCTTCGGGAACGCCAAGACCGTGAAGAATGACAACTCCTCCC
GC
TTCGGCAAATTCATTCGCATCAACTTTGATGTCAATGGCTACATTGTTGGAGCCAACATTGAGACTTA
T
CTTTTGGAGAAATCTCGTGCTATCCGCCAAGCCAAGGAAGAACGGACCTTCCACATCTTCTATTATCTC
CTG
TCTGGGGCTGGAGAGCACCTGAAGACCGATCTCCTGTTGGAGCCGTACAACAAATACCGCTTCCTGT
CC
AATGGACACGTCACCATCCCCGGGCAGCAGGACAAGGACATGTTCCAGGAGACCATGGAGGCCATGAG
G
ATTATGGGCATCCCAGAAGAGGAGCAAATGGGCCTGCTGCGGGTCATCTCAGGGGTTCTTCAGCTCGGC
AAC
ATCGTCTTCAAGAAGGAGCGGAACACTGACCAGGCGTCCATGCCCGACAACACAGCTGCCCAAAAGG
TG
TCCCATCTCTTGGGTATCAATGTGACCGATTTCACCAGAGGAATCCTCACCCCGCGCATCAAGGTGGG
A
CGGGATTACGTCCAGAAGGCGCAGACTAAAGAGCAGGCTGACTTTGCCATCGAGGCCTTGGCCAAGGCG
ACC
TATGAGCGGATGTTCCGCTGGCTGGTGCTGCGCATCAACAAGGCTCTGGACAAGACCAAGAGGCAGG
GC
GCCTCCTTCATCGGGATCCTGGACATTGCCGGCTTCGAGATCTTTGATCTGAACTCGTTTGAGCAGCT
G
TGCATCAATTACACCAATGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAG
GAG
TACCAGCGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGCCTCGACCTGCAGCCCTGCATCGACC
TC
ATTGAGAAGCCAGCAGGCCCCCCGGGCATTCTGGCCCTGCTGGACGAGGAGTGCTGGTTCCCCAAAGC
C
ACCGACAAGAGCTTCGTGGAGAAGGTGATGCAGGAGCAGGGCACCCACCCCAAGTTCCAGAAGCCCAAG
CAG
CTGAAGGACAAAGCTGATTTCTGCATTATCCACTATGCCGGCAAGGTGGATTACAAAGCTGACGAGT
GG
CTGATGAAGAACATGGATCCCCTGAATGACAACATCGCCACACTGCTCCACCAGTCCTCTGACAAGTT
T
GTCTCGGAGCTGTGGAAGGATGTGGACCGCATCATCGGCCTGGACCAGGTGGCCGGCATGTCGGAGACC
GCA
CTGCCCGGGGCCTTCAAGACGCGGAAGGGCATGTTCCGCACTGTGGGGCAGCTTTACAAGGAGCAGC
TG
GCCAAGCTGATGGCTACGCTGAGGAACACGAACCCCAACTTTGTCCGCTGCATCATCCCCAACCACGA
G
AAGAAGGCCGGCAAGCTGGACCCGCATCTCGTGCTGGACCAGCTGCGCTGCAACGGTGTTCTCGAGGGC
ATC
CGTATCTGCCGCCAGGGCTTCCCCAACAGGGTGGTCTTCCAGGAGTTTCGGCAGAGATATGAGATCC
TG
ACTCCAAACTCCATTCCCAAGGGTTTCATGGACGGGAAGCAGGCGTGCGTGCTCATGATAAAAGCCCT
G
GAGCTCGACAGCAATCTGTACCGCATTGGCCAGAGCAAAGTCTTCTTCCGTGCCGGTGTGCTGGCCCAC
CTG
GAGGAGGAGCGAGACCTGAAGATCACCGACGTCATCATAGGGTTCCAGGCCTGCTGCAGGGGCTACC
TG
GCCAGGAAAGCATTTGCCAAGCGGCAGCAGCAGCTTACCGCCATGAAGGTCCTCCAGCGGAACTGCGC
T
GCCTACCTGAAGCTGCGGAACTGGCAGTGGTGGCGGCTCTTCACCAAGGTCAAGCCGCTGCTGCAGGTG
AGC
CGGCAGGAGGAGGAGATGATGGCCAAGGAGGAGGAGCTGGTGAAGGTCAGAGAGAAGCAGCTGGCTG
CG
GAGAACAGGCTCACGGAGATGGAGACGCTGCAGTCTCAGCTCATGGCAGAGAAATTGCAGCTGCAGGA
G
CAGCTCCAGGCAGAAACCGAGCTGTGTGCCGAGGCTGAGGAGCTCCGGGCCCGCCTGACCGCCAAGAAG
CAG
GAATTAGAAGAGATCTGCCATGACCTAGAGGCCAGGGTGGAGGAGGAGGAGGAGCGCTGCCAGCACC
TG
CAGGCGGAGAAGAAGAAGATGCAGCAGAACATCCAGGAGCTTGAGGAGCAGCTGGAGGAGGAGGAGAG
C
GCCCGGCAGAAGCTGCAGCTGGAGAAGGTGACCACCGAGGCGAAGCTGAAAAAGCTGGAGGAGGAGCAG
ATC
ATCCTGGAGGACCAGAACTGCAAGCTGGCCAAGGAAAAGAAACTGCTGGAAGACAGAATAGCTGAGT
TC
ACCACCAACCTCACAGAAGAGGAGGAGAAATCTAAGAGCCTCGCCAAGCTCAAGAACAAGCATGAGGC
A
ATGATCACTGACTTGGAAGAGCGCCTCCGCAGGGAGGAGAAGCAGCGACAGGAGCTGGAGAAGACCCGC
CGG
AAGCTGGAGGGAGACTCCACAGACCTCAGCGACCAGATCGCCGAGCTCCAGGCCCAGATCGCGGAGC
TC
AAGATGCAGCTGGCCAAGAAAGAGGAGGAGCTCCAGGCCGCCCTGGCCAGAGTGGAAGAGGAAGCTGC
C
CAGAAGAACATGGCCCTCAAGAAGATCCGGGAGCTGGAATCTCAGATCTCTGAACTCCAGGAAGACCTG
GAG
TCTGAGCGTGCTTCCAGGAATAAAGCTGAGAAGCAGAAACGGGACCTTGGGGAAGAGCTAGAGGCTC
TG
AAAACAGAGTTGGAGGACACGCTGGATTCCACAGCTGCCCAGCAGGAGCTCAGGTCAAAACGTGAGCA
G
GAGGTGAACATCCTGAAGAAGACCCTGGAGGAGGAGGCCAAGACCCACGAGGCCCAGATCCAGGAGATG
AGG
CAGAAGCACTCACAGGCCGTGGAGGAGCTGGCGGAGCAGCTGGAGCAGACGAAGCGGGTGAAAGCAA
AC
CTCGAGAAGGCAAAGCAGACTCTGGAGAACGAGCGGGGGGAGCTGGCCAACGAGGTGAAGGTGCTGCT
G
CAGGGCAAAGGGGACTCGGAGCACAAGCGCAAGAAAGTGGAGGCGCAGCTGCAGGAGCTGCAGGTCAAG
TTC
AACGAGGGAGAGCGCGTGCGCACAGAGCTGGCCGACAAGGTCACCAAGCTGCAGGTGGAGCTGGACA
AC
GTGACCGGGCTTCTCAGCCAGTCCGACAGCAAGTCCAGCAAGCTCACCAAGGACTTCTCCGCGCTGGA
G
TCCCAGCTGCAGGACACTCAGGAGCTGCTGCAGGAGGAGAACCGGCAGAAGCTGAGCCTGAGCACCAAG
CTC
AAGCAGGTGGAGGACGAGAAGAATTCCTTCCGGGAGCAGCTGGAGGAGGAGGAGGAGGCCAAGCACA
AC
CTGGAGAAGCAGATCGCCACCCTCCATGCCCAGGTGGCCGACATGAAAAAGAAGATGGAGGACAGTGT
G
GGGTGCCTGGAAACTGCTGAGGAGGTGAAGAGGAAGCTCCAGAAGGACCTGGAGGGCCTGAGCCAGCGG
CAC
GAGGAGAAGGTGGCCGCCTACGACAAGCTGGAGAAGACCAAGACGCGGCTGCAGCAGGAGCTGGACG
AC
CTGCTGGTGGACCTGGACCACCAGCGCCAGAGCGCGTGCAACCTGGAGAAGAAGCAGAAGAAGTTTGA
C
CAGCTCCTGGCGGAGGAGAAGACCATCTCTGCCAAGTATGCAGAGGAGCGCGACCGGGCTGAGGCGGAG
GCC
CGAGAGAAGGAGACCAAGGCTCTGTCGCTGGCCCGGGCCCTGGAGGAAGCCATGGAGCAGAAGGCGG
AG
CTGGAGCGGCTCAACAAGCAGTTCCGCACGGAGATGGAGGACCTTATGAGCTCCAAGGATGATGTGGG
C
AAGAGTGTCCACGAGCTGGAGAAGTCCAAGCGGGCCCTAGAGCAGCAGGTGGAGGAGATGAAGACGCAG
CTG
GAAGAGCTGGAGGACGAGCTGCAGGCCACCGAAGATGCCAAGCTGCGGTTGGAGGTCAACCTGCAGG
CC
ATGAAGGCCCAGTTCGAGCGGGACCTGCAGGGCCGGGACGAGCAGAGCGAGGAGAAGAAGAAGCAGCT
G
GTCAGACAGGTGCGGGAGATGGAGGCAGAGCTGGAGGACGAGAGGAAGCAGCGCTCGATGGCAGTGGCC
GCC
CGGAAGAAGCTGGAGATGGACCTGAAGGACCTGGAGGCGCACATCGACTCGGCCAACAAGAACCGGG
AC
GAAGCCATCAAACAGCTGCGGAAGCTGCAGGCCCAGATGAAGGACTGCATGCGCGAGCTGGATGACAC
C
CGCGCCTCTCGTGAGGAGATCCTGGCCCAGGCCAAAGAGAACGAGAAGAAGCTGAAGAGCATGGAGGCC
GAG
ATGATCCAGTTGCAGGAGGAACTGGCAGCCGCGGAGCGTGCCAAGCGCCAGGCCCAGCAGGAGCGGG
AT
GAGCTGGCTGACGAGATCGCCAACAGCAGCGGCAAAGGAGCCCTGGCGTTAGAGGAGAAGCGGCGTCT
G
GAGGCCCGCATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACACGGAGCTGATCAACGAC
CGG
CTGAAGAAGGCCAACCTGCAGATCGACCAGATCAACACCGACCTGAACCTGGAGCGCAGCCACGCCC
AG
AAGAACGAGAATGCTCGGCAGCAGCTGGAACGCCAGAACAAGGAGCTTAAGGTCAAGCTGCAGGAGAT
G
GAGGGCACTGTCAAGTCCAAGTACAAGGCCTCCATCACCGCCCTCGAGGCCAAGATTGCACAGCTGGAG
GAG
CAGCTGGACAACGAGACCAAGGAGCGCCAGGCAGCCTGCAAACAGGTGCGTCGGACCGAGAAGAAGC
TG
AAGGATGTGCTGCTGCAGGTGGATGACGAGCGGAGGAACGCCGAGCAGTACAAGGACCAGGCCGACAA
G
GCATCTACCCGCCTGAAGCAGCTCAAGCGGCAGCTGGAGGAGGCCGAAGAGGAGGCCCAGCGGGCCAAC
GCC
TCCCGCCGGAAACTGCAGCGCGAGCTGGAGGACGCCACTGAGACGGCCGATGCCATGAACCGCGAAG
TC
AGCTCCCTAAAGAACAAGCTCAGGCGCGGGGACCTGCCGTTTGTCGTGCCCCGCCGAATGGCCCGGAA
A
GGCGCCGGGGATGGCTCCGACGAAGAGGTAGATGGCAAAGCGGATGGGGCTGAGGCCAAACCTGCCGAA
TAA


Translation (1960 aa):
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKD
D
IQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIY
TYSGLFCVVINPYKNLPIYSEEIVEMYKG
K
KRHEMPPHIYAITDTAYRSMMQ
DREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKKDQGELERQ
L
LQANPILEAFGNAKTVKNDNSSRF
GKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYL
L
SGAGEHLK
TDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLG
N
IVFKKERNTDQASMPDNT
AAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
T
YERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFD
LNSFEQLCINYTNEKLQQLFNHTMFILEQE
E
YQREGIEWNFIDFGLDLQPCIDLIEKP
AGPPGILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPK
Q
LKDKADFCIIHYAGK
VDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSET
A
LPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKK
AGKLDPHLVLDQLRCNGVLEG
I
RICRQGFPNRVVFQEFRQ
RYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAH
L
EEERDLKITDVIIGFQACCRGYLAR
KAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
S
RQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQ
LMAEKLQLQEQLQAETELCAEAEELRARLTAKK
Q
ELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQ
ELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQ
I
ILEDQNCKLAK
EKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTR
R
KLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALA
RVEEEAAQKNMALKKIRELESQISELQEDL
E
SERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQEL
RSKREQEVNILKKTLEEEAKTHEAQIQEM
R
QKHSQAVEELAEQLEQTKR
VKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK
F
NEGERVRTELADKVTKLQ
VELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTK
L
KQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQ
VADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQR
H
EEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQ
LLAEEKTISAKYAEERDRAEAE
A
REKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKS
VHELEKSKRALEQQVEEMKTQ
L
EELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQ
VREMEAELEDERKQRSMAVA
A
RKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQ
AQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
E
MIQLQE
ELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELIND
R
LKKANLQ
IDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLE
E
QLDNET
KERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRAN
A
SRRKLQRELEDATETADAMNREVSSLKNKL
RRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser