NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS13548.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13548.1 Public Homo sapiens 20 ZNF512B 22 109 92 CCDS HistoryNCBI Gene:57473Re-query CCDS DB by CCDS ID:13548.1Re-query CCDS DB by GeneID:57473See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13548.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000369888.5 ENSP00000358904.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000369888.5Link to Ensembl Protein Viewer:ENSP00000358904.1Re-query CCDS DB by Nucleotide ID:ENST00000369888Re-query CCDS DB by Protein ID:ENSP00000358904
Original member Current member NCBI NM_020713.2 NP_065764.1 Accepted alive Link to Nucleotide Sequence:NM_020713.2Link to Protein Sequence:NP_065764.1Re-query CCDS DB by Nucleotide ID:NM_020713Re-query CCDS DB by Protein ID:NP_065764Link to BLAST:NP_065764.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065764.1 892 Q96KM6 892 100% 0 0

Chromosomal Locations for CCDS 13548.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 63959888 63960139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63961309 63961407 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63961942 63962004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63962273 63962374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63962587 63962781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63963095 63963265 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63963342 63963440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63963618 63963710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63963789 63963913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63964071 63964217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63964320 63964391 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63964490 63964716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63966141 63966781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63966876 63967004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63967381 63967523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 63967830 63967950 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2679 nt):
ATGACGGATCCTTTCTGCGTTGGAGGCCGTCGGCTCCCGGGGTCCAGCAAGAGTGGTCCCGGGAAGGATG
GC
AGCCGAAAGGAGGTCCGACTTCCAATGCTGCATGACCCACCGAAGATGGGGATGCCGGTGGTCCGTGG
T
GGACAGACAGTGCCCGGCCAGGCCCCTCTCTGCTTTGACCCGGGAAGTCCAGCCAGTGACAAGACAGAA
GGG
AAGAAAAAGGGGCGGCCAAAAGCCGAGAACCAGGCCCTCCGAGACATTCCTCTCTCCCTGATGAACG
AC
TGGAAGGATGAGTTCAAGGCACACTCGAGGGTGAAGTGTCCAAACTCAGGGTGCTGGCTGGAGTTCCC
C
AGCATCTACGGGCTCAAGTACCATTACCAGCGGTGCCAAGGGGGTGCCATCTCAGATCGCCTGGCCTTC
CCC
TGCCCCTTCTGCGAGGCCGCATTCACCTCTAAGACCCAGCTGGAGAAACACCGGATCTGGAACCACA
TG
GACCGACCCCTGCCTGCCTCCAAGCCTGGGCCCATCAGCAGGCCGGTCACCATCAGCCGGCCTGTTGG
G
GTCAGCAAGCCCATCGGAGTGAGCAAACCTGTCACTATTGGCAAACCTGTGGGTGTCAGCAAACCCATT
GGC
ATCAGCAAGCCAGTCTCGGTCGGCAGACCCATGCCAGTCACCAAGGCCATCCCGGTCACTAGGCCCG
TG
CCAGTCACCAAACCTGTCACAGTCAGCAGGCCCATGCCCGTCACCAAGGCCATGCCGGTCACCAAACC
C
ATCACAGTCACCAAGTCTGTGCCGGTCACCAAACCCGTACCTGTCACCAAACCCATTACGGTAACAAAG
CTT
GTGACAGTTACGAAACCCGTGCCGGTCACCAAGCCAGTGACAGTCAGCAGGCCCATTGTGGTCAGCA
AG
CCGGTGACAGTCAGCAGGCCCATTGCTATCAGCAGACACACACCGCCCTGCAAAATGGTGCTGCTGAC
C
AGGTCGGAGAACAAAGCACCTCGTGCCACAGGGAGGAACAGTGGTAAGAAAAGGGCTGCGGACAGCCTG
GAC
ACCTGCCCAATTCCACCCAAGCAGGCCAGGCCAGAGAATGGGGAGTACGGCCCCTCCTCCATGGGCC
AG
AGCTCGGCCTTCCAGCTGAGTGCAGACACCAGCAGTGGCTCCTTGTCGCCAGGCAGCAGGCCGTCAGG
G
GGCATGGAGGCACTGAAGGCTGCAGGCCCTGCGTCCCCGCCTGAGGAGGACCCGGAGCGCACAAAGCAC
A
GA
AGGAAACAGAAAACACCCAAAAAGTTTACAGGGGAGCAGCCATCCATCTCAGGGACCTTTGGGCTCA
AA
GGCCTGGTCAAAGCTGAGGACAAGGCCCGAGTTCACCGCTCCAAGAAGCAGGAGGGGCCAGGCCCTGA
G
GACGCCCGGAAGAAGGTGCCAGCTGCCCCCATCACTGTCAGCAAGGAGGCACCGGCCCCTGTGGCCCAC
CCA
GCTCCAGGTGGCCCTGAAGAGCAGTGGCAGAGGGCCATCCATGAGCGCGGGGAAGCCGTCTGCCCCA
CC
TGCAACGTGGTCACCCGGAAGACTCTCGTGGGGCTTAAGAAGCACATGGAGGTGTGTCAGAAGCTTCA
G
GATGCACTCAAGTGCCAGCACTGCCGGAAGCAGTTCAAGTCCAAAGCCGGCCTCAACTACCACACTATG
GCC
GAGCACAGTGCCAAGCCCTCTGACGCCGAGGCCTCCGAAGGGGGCGAGCAGGAGGAGCGCGAGAGGC
TG
CGCAAGGTGCTGAAGCAGATGGGACGGCTGCGCTGCCCCCAGGAGGGTTGCGGGGCTGCCTTCTCCAG
C
CTCATGGGCTACCAGTACCACCAGCGGCGCTGCGGGAAGCCGCCCTGCGAGGTGGACAGCCCCTCCTTC
CCC
TGCACCCACTGTGGCAAGACGTACCGATCCAAGGCTGGCCACGACTACCACGTGCGCTCGGAGCACA
CG
GCCCCCCCCCCTGAGGAGCCCACAGACAAGTCCCCTGAGGCTGAGGACCCGCTGGGTGTGGAGCGGAC
C
CCAAGCGGGCGTGTCCGCCGCACGTCGGCCCAGGTGGCGGTGTTCCACCTGCAGGAGATAGCGGAGGAC
GAG
CTGGCCCGCGACTGGACCAAGCGGCGCATGAAGGATGACCTTGTGCCCGAGACCGCACGGCTCAACT
AC
ACTCGACCAGGGCTCCCCACGCTGAACCCCCAGCTGCTAGAGGCATGGAAGAATGAAGTGAAGGAGAA
A
GGCCACGTCAACTGTCCCAACGACTGCTGTGAAGCCATCTACTCCAGCGTGTCCGGACTCAAGGCTCAT
CTC
GCCAGCTGCAGTAAGGGGGCCCACCTGGCAGGGAAGTACCGCTGTCTGCTGTGTCCGAAGGAGTTCA
GT
TCTGAGAGTGGCGTCAAATACCACATCCTGAAGACCCACGCAGAGAACTGGTTCCGAACATCAGCAGA
C
CCACCTCCCAAACACAGGAGCCAGGACTCATTGGTGCCCAAGAAGGAAAAGAAGAAAAATCTGGCAGGT
GGA
AAGAAGCGGGGCCGAAAGCCCAAGGAGCGGACCCCAGAGGAGCCTGTGGCCAAGCTGCCCCCGCGCC
GG
GACGACTGGCCTCCAGGATGCAGAGACAAGGGGGCCCGGGGCTCCACCGGCCGGAAGGTGGGAGTCAG
C
AAGGCGCCTGAAAAGTGA


Translation (892 aa):
MTDPFCVGGRRLPGSSKSGPGKDGSRKEVRLPMLHDPPKMGMPVVRGGQTVPGQAPLCFDPGSPASDKTE
G
KKKGRPKAENQALRDIP
LSLMNDWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQGGAISDRLAF
P
CPFCEAAFTSKTQLEKHRIWNHMDRPLPASKPGPISRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKPI
G
ISKPVSVGRPMPVTKAIPVTRPVPVTKPVTVSRPMPVTKAMPVTKPITVTKSVPVTKPVPVTKPITVTK
L
VTVTKPVPVTKPVTVSRPIVVSKPVTVSRPIAISRHTPPCKMVLLTRSENKAPRATGRNSGKK
RAADSL
D
TCPIPPKQARPENGEYGPSSMGQSSAFQLSADTSSGSLSPGSRPSGGMEALKAAGPASPPEEDPERTKH

R
RKQKTPKKFTGEQPSISGTFGLKGLVKAEDKARVHRSKKQEGPGPEDARKKVPAAPITVSKEAPAPVAH
P
AP
GGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDALKCQHCRKQFKSKAGLNYHTM
A
EHSAK
PSDAEASEGGEQEERERLRKVLKQMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSF
P
CTHCGKTYRSKAGHDYHVRSEHTAP
PPEEPTDKSPEAEDPLGVERTPSGRVRRTSAQVAVFHLQEIAED
E
LARDWTKRRMKDDLVPETAR
LNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAH
L
ASCSK
GAHLAGKYRCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPPKHRSQDSLVPKKEKKKNLAG
G
KKRGRKPKERTPEEPVAKLPPRRDDWPPGCRDKGARGSTGRKVGVSKAPEK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser