NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS12561.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12561.1 Public Homo sapiens 19 NUMBL 22 109 92 CCDS HistoryNCBI Gene:9253Re-query CCDS DB by CCDS ID:12561.1Re-query CCDS DB by GeneID:9253See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12561.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000252891.8 ENSP00000252891.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000252891.8Link to Ensembl Protein Viewer:ENSP00000252891.3Re-query CCDS DB by Nucleotide ID:ENST00000252891Re-query CCDS DB by Protein ID:ENSP00000252891
Original member Current member NCBI NM_004756.4 NP_004747.1 Accepted alive Link to Nucleotide Sequence:NM_004756.4Link to Protein Sequence:NP_004747.1Re-query CCDS DB by Nucleotide ID:NM_004756Re-query CCDS DB by Protein ID:NP_004747Link to BLAST:NP_004747.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004747.1 609 Q9Y6R0 609 100% 0 0

Chromosomal Locations for CCDS 12561.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 40667468 40668138 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40669898 40670020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40673344 40673649 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40677232 40677421 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40680917 40681057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40682728 40682802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40682894 40682968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40684417 40684556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40686911 40686995 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 40690460 40690483 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1830 nt):
ATGTCCCGCAGCGCGGCGGCCAGCGGCGGACCCCGGAGGCCTGAGCGGCACCTGCCCCCAGCCCCCTGTG
GG
GCCCCGGGGCCCCCAGAAACCTGCAGGACGGAGCCAGACGGGGCGGGCACCATGAACAAGTTACGGCA
G
AGCCTGCGGCGGAGGAAGCCAGCCTACGTGCCCGAGGCGTCGCGCCCGCACCAGTGGCAGGCAGACGAG
GAC
GCGGTGCGGAAGGGCACGTGCAGCTTCCCGGTCAGGTACCTGGGTCACGTGGAGGTAGAGGAGTCCC
GG
GGAATGCACGTGTGTGAAGATGCGGTGAAGAAGCTGAAGGCGATGGGCCGAAAGTCCGTGAAGTCTGT
C
CTGTGGGTGTCAGCCGATGGGCTCCGAGTGGTGGACGACAAAACCAAGGATCTTCTGGTCGACCAGACC
ATC
GAAAAGGTCTCCTTTTGTGCTCCTGACCGCAACCTGGACAAGGCTTTCTCCTATATCTGTCGTGACG
GG
ACTACCCGCCGCTGGATCTGCCACTGTTTTCTGGCACTGAAGGACTCCGGCGAGAGGCTGAGCCACGC
T
GTGGGCTGTGCTTTTGCCGCCTGCCTGGAGCGAAAACAGCGACGGGAGAAGGAATGTGGGGTCACGGCC
GCC
TTCGATGCCAGCCGCACCAGCTTCGCCCGCGAGGGCTCCTTCCGCCTGTCTGGGGGTGGGCGGCCTG
CT
GAGCGAGAGGCCCCGGACAAGAAGAAAGCAGAGGCAGCAGCTGCCCCCACTGTGGCTCCTGGCCCTGC
C
CAGCCTGGGCACGTGTCCCCGACACCAGCCACCACATCCCCTGGTGAGAAGGGTGAGGCAGGCACCCCT
GTG
GCTGCAGGCACCACTGCGGCCGCCATCCCCCGGCGCCATGCACCCCTGGAGCAGCTGGTTCGCCAGG
GC
TCCTTCCGTGGGTTCCCAGCACTCAGCCAGAAGAACTCGCCTTTCAAACGGCAGCTGAGCCTACGGCT
G
AATGAGCTGCCATCCACGCTGCAGCGCCGCACTGACTTCCAGGTGAAGGGCACAGTGCCTGAGATGGAG
CCT
CCTGGTGCCGGCGACAGTGACAGCATCAACGCTCTGTGCACACAGATCAGTTCATCTTTTGCCAGTG
CT
GGAGCGCCAGCACCAGGGCCACCACCTGCCACAACAGGGACTTCTGCCTGGGGTGAGCCCTCCGTGCC
C
CCTGCAGCTGCCTTCCAGCCTGGGCACAAGCGGACACCTTCAGAGGCTGAGCGATGGCTGGAGGAGGTG
TCA
CAGGTGGCCAAGGCCCAGCAGCAGCAGCAGCAGCAACAGCAACAGCAGCAGCAGCAGCAGCAGCAAC
AG
CAGCAAGCAGCCTCAGTGGCCCCAGTGCCCACCATGCCTCCTGCCCTGCAGCCTTTCCCCGCCCCCGT
G
GGGCCCTTTGACGCTGCACCTGCCCAAGTGGCCGTGTTCCTGCCACCCCCACACATGCAGCCCCCTTTT
GTG
CCCGCCTACCCGGGCTTGGGCTACCCACCGATGCCCCGGGTGCCCGTGGTGGGCATCACACCCTCAC
AG
ATGGTGGCAAACGCCTTCTGCTCAGCCGCCCAGCTCCAGCCTCAGCCTGCCACTCTGCTTGGGAAAGC
T
GGGGCCTTCCCGCCCCCTGCCATACCCAGTGCCCCTGGGAGCCAGGCCCGCCCTCGCCCCAATGGGGCC
CCC
TGGCCCCCTGAGCCAGCGCCTGCCCCAGCTCCAGAGTTGGACCCCTTTGAGGCCCAGTGGGCGGCAT
TA
GAAGGCAAAGCCACTGTAGAGAAACCCTCCAACCCCTTTTCTGGCGACCTGCAAAAGACATTCGAGAT
T
GAACTGTAG


Translation (609 aa):
MSRSAAASGGPRRPERHLPPAPCGAPGPPETCRTEPDGAGTMNKLRQSLRRRKPAYVPEASRPHQWQADE
D
AVRKGTCSFPVR
YLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKSVLWVSADGLRVVDDKTKDLLVDQT
I
EKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDS
GERLSHAVGCAFAACLERKQRREKECGVTA
A
FDASRTSFAREGSFRLSGGGRPAEREAPDKKK
AEAAAAPTVAPGPAQPGHVSPTPATTSPGEKGEAGTP
V
AAGTTAAAIPRRHAPLEQLVRQGSFRGFPALSQKNSPFKRQLSLRLNELPSTLQRRTDFQVKGT
VPEME
P
PGAGDSDSINALCTQISSSFASAGAPAPGPPPATT
GTSAWGEPSVPPAAAFQPGHKRTPSEAERWLEEV
S
QVAKAQQQQQQQQQQQQQQQQQQQQAASVAPVPTMPPALQPFPAPVGPFDAAPAQVAVFLPPPHMQPPF
V
PAYPGLGYPPMPRVPVVGITPSQMVANAFCSAAQLQPQPATLLGKAGAFPPPAIPSAPGSQARPRPNGA
P
WPPEPAPAPAPELDPFEAQWAALEGKATVEKPSNPFSGDLQKTFEIEL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser