NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS12068.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12068.1 Public Homo sapiens 19 APC2 20 108 85 CCDS HistoryNCBI Gene:10297Re-query CCDS DB by CCDS ID:12068.1Re-query CCDS DB by GeneID:10297See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12068.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000233607 ENSP00000233607 Accepted alive Link to Ensembl Transcript Viewer:ENST00000233607Link to Ensembl Protein Viewer:ENSP00000233607Re-query CCDS DB by Nucleotide ID:ENST00000233607Re-query CCDS DB by Protein ID:ENSP00000233607
Original member Current member EBI,WTSI ENST00000535453 ENSP00000442954 Accepted alive Link to Ensembl Transcript Viewer:ENST00000535453Link to Ensembl Protein Viewer:ENSP00000442954Re-query CCDS DB by Nucleotide ID:ENST00000535453Re-query CCDS DB by Protein ID:ENSP00000442954
Original member Current member EBI,WTSI OTTHUMT00000449539 OTTHUMP00000263236 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000449539Link to Vega Protein Viewer:OTTHUMP00000263236Re-query CCDS DB by Nucleotide ID:OTTHUMT00000449539Re-query CCDS DB by Protein ID:OTTHUMP00000263236
Original member Current member NCBI NM_005883.2 NP_005874.1 Accepted alive Link to Nucleotide Sequence:NM_005883.2Link to Protein Sequence:NP_005874.1Re-query CCDS DB by Nucleotide ID:NM_005883Re-query CCDS DB by Protein ID:NP_005874Link to BLAST:NP_005874.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005874.1 2303 O95996-1 2303 100% 0 0

Chromosomal Locations for CCDS 12068.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 1453002 1453142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1453247 1453337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1453431 1453611 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1455149 1455257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1455384 1455500 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1456076 1456153 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1456306 1456404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1456853 1457243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1457965 1458060 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1460181 1460320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1460780 1460857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1461037 1461153 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1461963 1462177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 1465155 1470213 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6912 nt):
ATGGCGAGCTCCGTGGCGCCCTACGAGCAGCTGGTGAGGCAGGTGGAGGCCTTGAAGGCTGAGAACAGCC
AC
CTGAGGCAGGAGCTAAGGGACAACTCCAGCCACCTGTCCAAGCTGGAGACAGAGACGTCGGGCATGAA
G
GAGGTCCTGAAGCACCTACAGGGAAAACTGGAGCAGGAGGCCCGAGTGCTGGTGTCCTCGGGGCAGACG
GAG
GTGCTGGAGCAGCTGAAGGCCCTACAGATGGACATCACCAGCCTGTACAACCTCAAGTTCCAGCCGC
CC
ACCCTGGGCCCGGAGCCTGCCGCCCGGACCCCCGAGGGCAGCCCAGTACACGGCTCCGGGCCCTCCAA
G
GACAGCTTTGGGGAGCTGAGCCGGGCCACCATCCGGCTGCTGGAGGAACTGGACCGGGAACGGTGTTTC
CTG
CTGAATGAGATTGAGAAGGAGGAGAAGGAGAAGCTCTGGTACTACTCTCAGCTGCAGGGCCTGTCCA
AG
CGCCTGGACGAGCTGCCGCACGTGGAGACGCAGTTCTCGATGCAGATGGACCTGATCCGGCAGCAGCT
T
GAGTTCGAGGCCCAGCACATCCGCTCGCTGATGGAGGAGCGCTTCGGCACCTCGGACGAGATGGTGCAG
CGG
GCACAGATCCGCGCCTCGCGCCTGGAGCAGATTGACAAGGAGCTGCTGGAGGCGCAGGACCGAGTGC
AG
CAGACGGAGCCCCAGGCCTTGCTGGCGGTGAAGTCGGTGCCGGTGGACGAGGACCCCGAGACAGAGGT
C
CCCACACACCCTGAGGATGGCACCCCTCAGCCGGGCAACAGCAAGGTGGAGGTGGTCTTCTGGCTGTTG
TCC
ATGTTGGCGACGCGCGACCAGGAGGATACAGCGCGCACGCTGCTGGCCATGTCCAGCTCGCCCGAGA
GC
TGCGTGGCCATGCGCCGCTCGGGCTGTCTGCCTCTGCTGCTGCAAATCCTCCACGGCACCGAGGCCGC
G
GCCGGGGGTCGCGCCGGGGCCCCAGGGGCACCGGGCGCCAAGGACGCACGCATGCGCGCCAACGCGGCG
CTG
CACAACATCGTCTTCTCGCAGCCGGACCAGGGCCTGGCGCGCAAGGAGATGCGCGTCCTGCACGTGC
TG
GAGCAGATCCGGGCCTACTGCGAGACCTGCTGGGACTGGCTGCAGGCCCGAGACGGCGGGCCCGAGGG
A
GGTGGCGCCGGCAGCGCCCCGATCCCCATCGAGCCGCAGATCTGCCAGGCCACCTGTGCTGTTATGAAG
CTG
TCCTTTGATGAGGAGTACCGCCGTGCCATGAACGAGCTAGGTGGGCTGCAGGCCGTGGCAGAGCTGC
TG
CAGGTTGACTATGAGATGCACAAGATGACCCGGGACCCGCTGAACCTGGCGCTGCGCCGCTACGCGGG
C
ATGACCCTCACCAACCTCACCTTTGGGGACGTTGCCAACAAGGCCACCCTGTGTGCGCGCCGCGGCTGC
ATG
GAGGCCATCGTGGCCCAGCTGGCCTCCGACAGTGAGGAGCTCCACCAGGTGGTGTCCAGCATCCTTC
GG
AACTTGTCCTGGAGGGCCGACATCAACAGCAAGAAGGTGCTGAGGGAGGCGGGCAGCGTGACTGCCCT
G
GTGCAGTGTGTCCTGCGGGCCACCAAGGAGTCCACCCTGAAGAGCGTGCTGAGCGCCCTGTGGAATCTG
TCT
GCACACAGCACAGAGAACAAGGCGGCCATCTGCCAGGTGGATGGCGCCCTGGGCTTCCTGGTGAGCA
CC
CTGACCTACAAGTGTCAGAGCAACTCGCTGGCCATCATCGAGAGCGGCGGCGGCATCCTCCGCAATGT
G
TCCAGCCTCGTCGCCACCCGTGAGGACTACAGGCAGGTGCTCCGGGATCACAACTGTCTGCAGACGCTG
CTG
CAGCATCTGACTTCGCACAGCCTGACCATCGTGAGCAACGCGTGCGGCACGCTCTGGAACCTGTCGG
CC
CGCAGCGCCCGTGACCAGGAGCTGCTGTGGGACCTGGGCGCCGTGGGCATGCTGCGTAATCTGGTGCA
C
TCCAAGCACAAGATGATCGCCATGGGCAGCGCCGCCGCCCTGCGCAACCTGCTGGCCCATCGGCCCGCC
AAG
CACCAGGCGGCCGCCACCGCCGTGTCCCCAGGCAGCTGCGTGCCCAGCCTGTACGTGCGCAAGCAGC
GG
GCGCTGGAGGCCGAGCTGGACGCACGGCACCTCGCGCAGGCGCTGGAGCACCTGGAGAAGCAGGGCCC
G
CCGGCAGCCGAGGCCGCCACTAAGAAGCCGCTGCCGCCCCTGCGACACCTGGACGGCCTGGCCCAAGAC
TAT
GCTTCCGATTCGGGCTGCTTTGACGACGACGATGCACCGTCATCCCTGGCTGCGGCCGCGGCCACCG
GG
GAGCCAGCCAGCCCTGCCGCGCTGTCCCTCTTCCTGGGCAGCCCCTTCCTGCAGGGGCAGGCGCTGGC
T
CGCACCCCGCCCACCCGCCGAGGCGGCAAGGAGGCAGAGAAGGACACCAGTGGGGAGGCAGCCGTGGCG
GCC
AAGGCCAAGGCCAAGCTGGCGCTTGCAGTGGCGCGCATCGACCAGCTGGTGGAGGACATCTCCGCCC
TG
CACACCTCGTCCGACGATAGCTTCAGCCTCAGCTCTGGAGACCCGGGACAGGAGGCGCCACGGGAGGG
C
CGCGCCCAGTCCTGCTCGCCATGCCGCGGCCCGGAGGGCGGGCGGCGAGAGGCAGGAAGCCGGGCGCAC
CCG
CTGCTGCGGCTCAAGGCGGCCCACGCCAGCCTCTCCAACGACAGCCTCAACAGCGGCAGTGCCAGCG
AC
GGGTACTGCCCACGCGAACATATGCTGCCCTGCCCGCTGGCCGCACTGGCTTCGCGCCGCGAGGACCC
C
AGGTGTGGGCAGCCTCGGCCCAGCCGGCTTGACCTTGACCTGCCCGGCTGCCAGGCCGAGCCCCCGGCC
CGC
GAGGCCACCTCCGCCGACGCCCGCGTGCGCACCATCAAGCTGTCGCCTACCTATCAGCACGTGCCAC
TG
CTTGAGGGTGCCTCAAGGGCGGGTGCAGAGCCCCTCGCGGGGCCTGGAATCTCTCCAGGGGCCCGGAA
G
CAGGCCTGGCTGCCGGCAGACCACCTGAGCAAGGTTCCCGAGAAGCTGGCGGCTGCCCCGCTGTCTGTG
GCC
AGCAAGGCACTGCAGAAACTGGCGGCGCAAGAGGGGCCACTCTCGCTGTCCCGATGCAGCTCCCTTT
CC
TCGCTGTCCTCGGCCGGCCGCCCAGGCCCCAGCGAGGGTGGTGACCTGGATGACAGTGACTCCTCCCT
G
GAGGGGCTGGAGGAGGCCGGCCCCAGCGAGGCTGAGCTGGACAGCACGTGGCGGGCGCCCGGGGCCACC
TCG
CTGCCCGTAGCCATTCCGGCTCCCCGGCGTAACCGAGGCCGGGGCCTGGGGGTGGAAGACGCCACGC
CG
TCCAGCTCGTCGGAGAACTACGTGCAGGAGACACCGCTTGTGCTGAGCCGCTGCAGCTCTGTGAGCTC
G
CTGGGCAGCTTCGAGAGCCCGTCCATCGCCAGCTCCATCCCCAGTGAACCTTGCAGCGGGCAGGGCAGC
GGC
ACCATCAGCCCTAGCGAGCTGCCCGACAGCCCCGGACAGACCATGCCTCCCAGCCGGAGCAAGACGC
CA
CCGCTGGCGCCCGCGCCACAGGGTCCCCCCGAGGCCACCCAGTTCAGCCTGCAGTGGGAGAGCTACGT
G
AAGCGCTTCCTGGACATCGCCGACTGCCGGGAGCGCTGCCGGCTGCCATCTGAGCTGGACGCAGGCAGC
GTG
CGCTTTACCGTGGAGAAGCCAGACGAGAACTTCTCGTGCGCCTCCAGCCTCAGCGCGCTGGCCTTGC
AC
GAGCACTACGTGCAGCAGGACGTGGAGCTGCGGCTGCTGCCCTCGGCCTGCCCCGAGCGCGGCGGGGG
C
GCCGGGGGCGCCGGCCTCCACTTTGCAGGGCACCGGCGGCGGGAGGAGGGGCCGGCGCCCACGGGTTCT
CGC
CCTCGCGGCGCCGCGGACCAGGAGCTGGAACTGCTGCGGGAGTGCCTGGGAGCCGCCGTGCCTGCCC
GG
CTGCGCAAGGTGGCCTCCGCGCTGGTGCCAGGTCGCCGCGCACTCCCCGTGCCCGTCTACATGTTGGT
G
CCCGCCCCGGCCCCGGCCCAGGAGGACGACTCCTGCACTGACTCCGCGGAGGGCACGCCGGTCAACTTC
TCT
AGCGCCGCCTCGCTCAGCGACGAGACGCTGCAGGGACCCCCCAGGGACCAGCCCGGGGGACCAGCGG
GC
AGGCAAAGACCCACCGGCCGCCCCACCTCTGCCAGACAGGCCATGGGGCACCGGCACAAGGCGGGAGG
C
GCCGGCCGCAGCGCGGAGCAGTCTCGGGGCGCGGGCAAGAACAGAGCAGGGCTGGAGCTGCCCCTGGGC
CGG
CCCCCGAGCGCCCCCGCAGACAAGGACGGCTCAAAGCCCGGCCGGACCCGCGGGGACGGGGCGCTCC
AG
TCGCTGTGCCTCACGACGCCCACTGAGGAGGCCGTGTACTGCTTCTACGGCAACGACTCGGACGAGGA
G
CCCCCGGCGGCCGCGCCCACGCCAACCCACCGGCGCACATCGGCCATCCCTCGCGCTTTTACGCGGGAG
CGT
CCGCAGGGCCGGAAGGAGGCCCCTGCCCCGTCCAAGGCTGCACCAGCTGCCCCGCCGCCCGCCCGGA
CC
CAGCCCAGCCTCATTGCTGACGAGACCCCGCCCTGCTACTCCCTGAGCTCCTCCGCCAGCTCCCTCAG
C
GAGCCCGAGCCCTCGGAGCCGCCGGCCGTCCATCCACGAGGCCGGGAGCCCGCGGTCACCAAGGACCCG
GGC
CCAGGAGGCGGACGCGACAGCTCGCCCAGCCCGCGGGCCGCGGAGGAGCTTCTGCAGCGGTGCATCA
GC
TCGGCCCTGCCCAGGCGCCGGCCCCCCGTGTCTGGCCTGCGGCGCCGCAAGCCCCGAGCCACCCGGCT
G
GATGAGCGGCCCGCAGAGGGGTCCCGGGAACGCGGCGAGGAGGCAGCGGGCTCGGACCGGGCCTCCGAC
CTG
GATAGCGTGGAGTGGCGCGCCATCCAGGAGGGCGCCAATTCAATTGTCACGTGGCTGCACCAGGCAG
CA
GCTGCCACGCGGGAGGCCTCGTCCGAGTCCGACTCCATCCTGTCCTTCGTATCCGGGCTGTCAGTGGG
A
TCCACCCTACAGCCCCCCAAGCACAGGAAGGGACGACAGGCGGAGGGAGAAATGGGCAGTGCCCGGCGG
CCA
GAGAAAAGGGGCGCAGCCTCAGTCAAGACCAGCGGGAGCCCCCGTTCCCCTGCAGGCCCCGAGAAGC
CA
CGTGGCACACAGAAGACCACGCCCGGGGTGCCAGCTGTGCTCCGGGGACGAACAGTGATCTACGTCCC
C
AGCCCGGCACCCCGTGCCCAGCCCAAAGGGACCCCCGGCCCCCGCGCCACACCGCGGAAGGTGGCGCCC
CCT
TGCCTGGCACAGCCCGCGGCTCCAGCCAAAGTCCCGAGCCCCGGGCAGCAGCGGTCGCGGAGCCTAC
AC
CGGCCTGCCAAGACCTCGGAGCTGGCGACGCTGAGCCAGCCCCCCAGAAGCGCCACACCGCCCGCCCG
C
CTCGCCAAGACCCCCTCCTCCAGCTCCTCCCAGACCTCGCCCGCCTCCCAGCCCCTGCCCAGAAAGCGC
CCC
CCGGTCACCCAGGCTGCTGGGGCCCTGCCCGGCCCCGGAGCCTCCCCGGTGCCCAAAACGCCGGCGC
GC
ACCCTTCTGGCGAAGCAGCACAAGACGCAGAGATCGCCCGTGCGGATCCCGTTCATGCAGAGGCCGGC
C
CGGCGTGGGCCGCCACCGCTGGCTCGGGCAGTCCCGGAGCCGGGCCCCAGGGGCCGGGCGGGGACCGAG
GCG
GGCCCGGGGGCGCGCGGGGGCCGCCTGGGCCTGGTGCGTGTGGCCTCAGCCCTCTCCAGCGGCAGCG
AG
TCCTCCGACCGCTCGGGCTTCCGGCGACAGCTAACCTTCATCAAGGAGTCGCCGGGCTTGCGGCGCCG
C
CGCTCCGAGCTGTCCTCGGCCGAGTCCGCGGCCTCTGCCCCCCAGGGCGCCTCGCCCCGCCGCGGCCGG
CCC
GCGCTGCCCGCCGTCTTCCTCTGCTCCTCGCGCTGCGAAGAGCTCCGAGCGGCACCCCGGCAGGGCC
CG
GCCCCGGCCCGGCAGCGGCCCCCCGCGGCCCGACCCAGCCCTGGCGAGCGCCCTGCCCGGCGCACCAC
C
TCCGAGAGCCCGTCCCGCCTGCCTGTGCGCGCGCCCGCCGCCCGGCCGGAGACTGTCAAGCGCTACGCG
TCG
CTGCCGCACATCAGCGTGGCCCGCAGGCCCGACGGCGCCGTCCCCGCGGCCCCTGCCTCAGCCGACG
CC
GCGCGCCGCAGCAGCGACGGGGAGCCCCGGCCGCTCCCCAGGGTGGCCGCGCCGGGCACGACCTGGCG
G
CGCATCCGAGATGAGGACGTGCCCCACATCCTGCGCAGCACGCTTCCCGCCACGGCCCTGCCACTGCGG
GGC
TCCACGCCCGAGGACGCCCCGGCCGGGCCCCCGCCGCGCAAGACCAGCGACGCCGTGGTCCAGACCG
AG
GAGGTCGCCGCCCCCAAGACCAACTCCAGCACGTCCCCGAGCCTGGAGACCAGGGAGCCCCCCGGGGC
C
CCCGCCGGCGGCCAGCTCTCCCTCCTCGGCAGCGACGTGGACGGTCCCAGCCTCGCCAAGGCTCCCATC
TCC
GCACCCTTCGTGCACGAGGGCCTGGGGGTCGCCGTGGGGGGCTTCCCCGCCAGCCGGCACGGCTCCC
CC
AGCCGCTCGGCCCGAGTACCCCCCTTCAACTATGTGCCCAGCCCCATGGTGGTCGCAGCCACCACCGA
C
TCGGCCGCGGAGAAAGCCCCGGCCACTGCCTCCGCCACCCTCCTGGAATAG


Translation (2303 aa):
MASSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQEARVLVSSGQT
E
VLEQLK
ALQMDITSLYNLKFQPPTLGPEPAARTPEGSPVHGSGPSKDSFGELSRATIRLLEELDRERCF
L
LNEIEKEEKEKLWYYSQLQGLSKRLDELPHVET
QFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQ
R
AQ
IRASRLEQIDKELLEAQDRVQQTEPQALLAVKSVPVDEDPETEVPTHPEDGTPQPGNSKVEVVFWLL
S
MLATRDQEDTARTLLAMSSSPESCVAMRRSGCLPLLLQILHGTEAAAGGRAGAPGAPGAKDARMRANAA
L
HNIVFSQPDQGLARKEMRVLHVLEQIRAYCETCWDWLQARDGGPEGGGAGS
APIPIEPQICQATCAVMK
L
SFDEEYRRAMNEL
GGLQAVAELLQVDYEMHKMTRDPLNLALRRYAGMTLTNLTFGDVANKATLCARRGC
M
EAIVAQLASDSEELHQ
VVSSILRNLSWRADINSKKVLREAGSVTALVQCVLRATKESTLKSVLSALWNL
S
AHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIESGGGILRNVSSLVATREDY
RQVLRDHNCLQTL
L
QHLTSHSLTIVSNACGTLWNLSARSARDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPA
K
HQAAATAVSPGSCVPSLYVRKQRALEAELDARHLAQALEHLEKQGPPAAEAATKKPLPPLRHLDGLAQD
Y
ASDSGCFDDDDAPSSLAAAAATGEPASPAALSLFLGSPFLQGQALARTPPTRRGGKEAEKDTSGEAAVA
A
KAKAKLALAVARIDQLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRGPEGGRREAGSRAH
P
LLRLKAAHASLSNDSLNSGSASDGYCPREHMLPCPLAALASRREDPRCGQPRPSRLDLDLPGCQAEPPA
R
EATSADARVRTIKLSPTYQHVPLLEGASRAGAEPLAGPGISPGARKQAWLPADHLSKVPEKLAAAPLSV
A
SKALQKLAAQEGPLSLSRCSSLSSLSSAGRPGPSEGGDLDDSDSSLEGLEEAGPSEAELDSTWRAPGAT
S
LPVAIPAPRRNRGRGLGVEDATPSSSSENYVQETPLVLSRCSSVSSLGSFESPSIASSIPSEPCSGQGS
G
TISPSELPDSPGQTMPPSRSKTPPLAPAPQGPPEATQFSLQWESYVKRFLDIADCRERCRLPSELDAGS
V
RFTVEKPDENFSCASSLSALALHEHYVQQDVELRLLPSACPERGGGAGGAGLHFAGHRRREEGPAPTGS
R
PRGAADQELELLRECLGAAVPARLRKVASALVPGRRALPVPVYMLVPAPAPAQEDDSCTDSAEGTPVNF
S
SAASLSDETLQGPPRDQPGGPAGRQRPTGRPTSARQAMGHRHKAGGAGRSAEQSRGAGKNRAGLELPLG
R
PPSAPADKDGSKPGRTRGDGALQSLCLTTPTEEAVYCFYGNDSDEEPPAAAPTPTHRRTSAIPRAFTRE
R
PQGRKEAPAPSKAAPAAPPPARTQPSLIADETPPCYSLSSSASSLSEPEPSEPPAVHPRGREPAVTKDP
G
PGGGRDSSPSPRAAEELLQRCISSALPRRRPPVSGLRRRKPRATRLDERPAEGSRERGEEAAGSDRASD
L
DSVEWRAIQEGANSIVTWLHQAAAATREASSESDSILSFVSGLSVGSTLQPPKHRKGRQAEGEMGSARR
P
EKRGAASVKTSGSPRSPAGPEKPRGTQKTTPGVPAVLRGRTVIYVPSPAPRAQPKGTPGPRATPRKVAP
P
CLAQPAAPAKVPSPGQQRSRSLHRPAKTSELATLSQPPRSATPPARLAKTPSSSSSQTSPASQPLPRKR
P
PVTQAAGALPGPGASPVPKTPARTLLAKQHKTQRSPVRIPFMQRPARRGPPPLARAVPEPGPRGRAGTE
A
GPGARGGRLGLVRVASALSSGSESSDRSGFRRQLTFIKESPGLRRRRSELSSAESAASAPQGASPRRGR
P
ALPAVFLCSSRCEELRAAPRQGPAPARQRPPAARPSPGERPARRTTSESPSRLPVRAPAARPETVKRYA
S
LPHISVARRPDGAVPAAPASADAARRSSDGEPRPLPRVAAPGTTWRRIRDEDVPHILRSTLPATALPLR
G
STPEDAPAGPPPRKTSDAVVQTEEVAAPKTNSSTSPSLETREPPGAPAGGQLSLLGSDVDGPSLAKAPI
S
APFVHEGLGVAVGGFPASRHGSPSRSARVPPFNYVPSPMVVAATTDSAAEKAPATASATLLE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser