NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS11416.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11416.1 Public Homo sapiens 17 DHX58 22 109 92 CCDS HistoryNCBI Gene:79132Re-query CCDS DB by CCDS ID:11416.1Re-query CCDS DB by GeneID:79132See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11416.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000251642.7 ENSP00000251642.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000251642.7Link to Ensembl Protein Viewer:ENSP00000251642.3Re-query CCDS DB by Nucleotide ID:ENST00000251642Re-query CCDS DB by Protein ID:ENSP00000251642
Original member NCBI NM_024119.2 NP_077024.2 Updated not alive Link to Nucleotide Sequence:NM_024119.2Link to Protein Sequence:NP_077024.2Re-query CCDS DB by Nucleotide ID:NM_024119Re-query CCDS DB by Protein ID:NP_077024
Current member NCBI NM_024119.3 NP_077024.2 Accepted alive Link to Nucleotide Sequence:NM_024119.3Link to Protein Sequence:NP_077024.2Re-query CCDS DB by Nucleotide ID:NM_024119Re-query CCDS DB by Protein ID:NP_077024Link to BLAST:NP_077024.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077024.2 678 Q96C10 678 100% 0 0

Chromosomal Locations for CCDS 11416.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 42101761 42101946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 42102216 42102312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 42103608 42103798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 42104766 42104927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 42105018 42105167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 42105736 42105989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 42107604 42107795 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 42107982 42108108 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 42109270 42109386 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 42110723 42110913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 42111296 42111497 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 42111725 42111892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2037 nt):
ATGGAGCTTCGGTCCTACCAATGGGAGGTGATCATGCCTGCCCTGGAGGGCAAGAATATCATCATCTGGC
TG
CCCACGGGTGCCGGGAAGACCCGGGCGGCTGCTTATGTGGCCAAGCGGCACCTAGAGACTGTGGATGG
A
GCCAAGGTGGTTGTATTGGTCAACAGGGTGCACCTGGTGACCCAGCATGGTGAAGAGTTCAGGCGCATG
CTG
GATGGACGCTGGACCGTGACAACCCTGAGTGGGGACATGGGACCACGTGCTGGCTTTGGCCACCTGG
CC
CGGTGCCATGACCTGCTCATCTGCACAGCAGAGCTTCTGCAGATGGCACTGACCAGCCCCGAGGAGGA
G
GAGCACGTGGAGCTCACTGTCTTCTCCCTGATCGTGGTGGATGAGTGCCACCACACGCACAAGGACACC
GTC
TACAACGTCATCATGAGCCAGTACCTAGAACTTAAACTCCAGAGGGCACAGCCGCTACCCCAGGTGC
TG
GGTCTCACAGCCTCCCCAGGCACTGGCGGGGCCTCCAAACTCGATGGGGCCATCAACCACGTCCTGCA
G
CTCTGTGCCAACTTGGACACGTGGTGCATCATGTCACCCCAGAACTGCTGCCCCCAGCTGCAGGAGCAC
AGC
CAACAGCCTTGCAAACAGTACAACCTCTGCCACAGGCGCAGCCAGGATCCGTTTGGGGACTTGCTGA
AG
AAGCTCATGGACCAAATCCATGACCACCTGGAGATGCCTGAGTTGAGCCGGAAATTTGGGACGCAAAT
G
TATGAGCAGCAGGTGGTGAAGCTGAGTGAGGCTGCGGCTTTGGCTGGGCTTCAGGAGCAACGGGTGTAT
GCG
CTTCACCTGAGGCGCTACAATGACGCGCTGCTCATCCATGACACCGTCCGCGCCGTGGATGCCTTGG
CT
GCGCTGCAGGATTTCTATCACAGGGAGCACGTCACTAAAACCCAGATCCTGTGTGCCGAGCGCCGGCT
G
CTGGCCCTGTTCGATGACCGCAAGAATGAGCTGGCCCACTTGGCAACTCATGGCCCAGAGAATCCAAAA
CTG
GAGATGCTGGAAAAGATCCTGCAAAGGCAGTTCAGTAGCTCTAACAGCCCTCGGGGTATCATCTTCA
CC
CGCACCCGCCAAAGCGCACACTCCCTCCTGCTCTGGCTCCAGCAGCAGCAGGGCCTGCAGACTGTGGA
C
ATCCGGGCCCAGCTACTGATTGGGGCTGGGAACAGCAGCCAGAGCACCCACATGACCCAGAGGGACCAG
CAA
GAAGTGATCCAGAAGTTCCAAGATGGAACCCTGAACCTTCTGGTGGCCACGAGTGTGGCGGAGGAGG
GG
CTGGACATCCCACATTGCAATGTGGTGGTGCGTTATGGGCTCTTGACCAATGAAATCTCCATGGTCCA
G
GCCAGGGGCCGTGCCCGGGCCGATCAGAGTGTATACGCGTTTGTAGCAACTGAAGGTAGCCGGGAGCTG
AAG
CGGGAGCTGATCAACGAGGCGCTGGAGACGCTGATGGAGCAGGCAGTGGCTGCTGTGCAGAAAATGG
AC
CAGGCCGAGTACCAGGCCAAGATCCGGGATCTGCAGCAGGCAGCCTTGACCAAGCGGGCGGCCCAGGC
A
GCCCAGCGGGAGAACCAGCGGCAGCAGTTCCCAGTGGAGCACGTGCAGCTACTCTGCATCAACTGCATG
GTG
GCTGTGGGCCATGGCAGCGACCTGCGGAAGGTGGAGGGCACCCACCATGTCAATGTGAACCCCAACT
TC
TCGAACTACTATAATGTCTCCAGGGATCCTGTGGTCATCAACAAAGTCTTCAAGGACTGGAAGCCTGG
G
GGTGTCATCAGCTGCAGGAACTGTGGGGAGGTCTGGGGTCTGCAGATGATCTACAAGTCAGTGAAGCTG
CCA
GTGCTCAAAGTCCGCAGCATGCTGCTGGAGACCCCTCAGGGGCGGATCCAGGCCAAAAAGTGGTCCC
GC
GTGCCCTTCTCCGTGCCTGACTTTGACTTCCTGCAGCATTGTGCCGAGAACTTGTCGGACCTCTCCCT
G
GACTGA


Translation (678 aa):
MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRM
L
DGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELT
VFSLIVVDECHHTHKDT
V
YNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQ
LCANLDTWCIMSPQNCCPQLQEH
S
QQPCKQYNLCHRRSQ
DPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVY
A
LHLRRYNDALLIHDTVRAVDALAALQDFYHREHVTKTQILCAERRLLALFD
DRKNELAHLATHGPENPK
L
EMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQ
RDQ
Q
EVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQ
ARGRARADQSVYAFVATEGSREL
K
RELINEALETLMEQAVAAVQKMDQAEYQAK
IRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCM
V
AVGHGSDLRKVEGTHHVNVNPNF
SNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKL
P
VLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser