NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS10992.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10992.1 Public Homo sapiens 16 GAS8 22 109 92 CCDS HistoryNCBI Gene:2622Re-query CCDS DB by CCDS ID:10992.1Re-query CCDS DB by GeneID:2622See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10992.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000268699.8 ENSP00000268699.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000268699.8Link to Ensembl Protein Viewer:ENSP00000268699.4Re-query CCDS DB by Nucleotide ID:ENST00000268699Re-query CCDS DB by Protein ID:ENSP00000268699
Original member NCBI NM_001481.2 NP_001472.1 Updated not alive Link to Nucleotide Sequence:NM_001481.2Link to Protein Sequence:NP_001472.1Re-query CCDS DB by Nucleotide ID:NM_001481Re-query CCDS DB by Protein ID:NP_001472
Current member NCBI NM_001481.3 NP_001472.1 Accepted alive Link to Nucleotide Sequence:NM_001481.3Link to Protein Sequence:NP_001472.1Re-query CCDS DB by Nucleotide ID:NM_001481Re-query CCDS DB by Protein ID:NP_001472Link to BLAST:NP_001472.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001472.1 478 O95995-1 478 100% 0 0

Chromosomal Locations for CCDS 10992.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 90022722 90022724 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90027636 90027722 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90031299 90031496 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90032718 90032924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90035633 90035687 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90036381 90036586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90037232 90037399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90037762 90037848 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90040300 90040509 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90042470 90042535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 90043196 90043345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1437 nt):
ATGGCACCGAAAAAGAAAGGGAAGAAAGGCAAAGCCAAAGGCACCCCGATTGTCGATGGGCTCGCTCCAG
AG
GACATGAGCAAGGAGCAGGTGGAGGAGCATGTCAGCCGCATCCGGGAGGAGCTGGACCGCGAGCGGGA
G
GAACGAAACTACTTCCAGCTGGAGCGGGACAAGATCCACACCTTCTGGGAGATCACACGGAGGCAGCTG
GAG
GAGAAGAAGGCTGAGCTGCGGAACAAAGACCGGGAGATGGAAGAAGCCGAGGAGAGGCACCAGGTGG
AG
ATCAAGGTGTACAAGCAGAAAGTGAAGCACCTGCTATATGAGCACCAGAACAACCTGACAGAGATGAA
G
GCTGAGGGCACTGTAGTCATGAAGCTGGCACAGAAAGAGCACCGCATACAGGAGAGTGTGCTGCGCAAG
GAC
ATGCGGGCACTGAAGGTGGAGCTCAAGGAGCAGGAGCTGGCCAGTGAGGTGGTGGTGAAGAACCTGC
GG
CTGAAACACACCGAGGAGATCACCAGGATGCGGAATGATTTTGAGAGGCAAGTTCGAGAAATTGAGGC
C
AAGTATGATAAGAAGATGAAGATGCTGAGGGACGAACTCGACTTGCGGAGAAAGACTGAGCTCCACGAA
GTG
GAGGAGAGGAAGAATGGCCAGATCCACACGCTGATGCAGCGCCACGAGGAGGCCTTCACCGACATTA
AG
AACTACTACAACGACATCACCCTCAACAACCTGGCCCTCATCAACTCCCTCAAGGAGCAGATGGAGGA
C
ATGCGGAAGAAGGAGGACCACCTGGAGAGGGAGATGGCAGAGGTGTCTGGGCAGAACAAGCGCCTGGCA
GAC
CCTCTCCAGAAGGCTCGGGAGGAGATGAGCGAGATGCAGAAACAGCTCGCAAACTACGAGAGGGACA
AG
CAGATCCTGCTTTGCACAAAAGCCCGTTTGAAAGTCAGGGAGAAAGAGCTGAAAGACCTGCAGTGGGA
G
CATGAAGTGTTAGAGCAGCGATTCACCAAGGTGCAGCAGGAGCGGGACGAGCTCTATCGGAAGTTCACC
GCA
GCCATCCAGGAGGTGCAGCAGAAGACAGGGTTCAAGAACCTCGTGCTAGAACGCAAGCTGCAGGCTC
TG
AGCGCCGCTGTGGAGAAGAAGGAGGTGCAGTTCAACGAGGTCCTGGCTGCCTCTAACCTGGACCCTGC
A
GCCCTGACGCTGGTGTCCCGCAAGCTGGAGGATGTTCTTGAGTCGAAGAACAGCACCATCAAGGACCTG
CAG
TATGAGCTGGCCCAGGTCTGTAAGGCCCATAACGACCTGCTGCGCACGTATGAGGCAAAGCTGCTGG
CC
TTCGGGATCCCTCTGGACAACGTGGGCTTCAAGCCCTTGGAAACAGCTGTGATCGGACAGACACTGGG
C
CAGGGCCCCGCGGGACTGGTGGGCACCCCGACGTAG


Translation (478 aa):
MAPKKKGKKGKAKGTPIVDGLAPEDMSKEQVEEHVSRIREELDREREERNYFQLERDKIHTFWEITRRQL
E
EKKAELRNKDREMEEAEERHQVEIK
VYKQKVKHLLYEHQNNLTEMKAEGTVVMKLAQKEHRIQESVLRK
D
MRALKVELKEQELASEVVVKNLRL
KHTEEITRMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTELHE
V
EERKNGQIHTLMQRHEEAFTDIKNYYNDITLNNLALINSLK
EQMEDMRKKEDHLEREMAEVSGQNKRLA
D
PLQKAREEMSEMQKQLANYERDKQILL
CTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFT
A
AIQEVQQKTGFKNLVLERKLQALSAAVEKKEVQFNEVLAASNLDPAALTLVSRKLE
DVLESKNSTIKDL
Q
YELAQVCK
AHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGTPT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser