NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10952.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10952.1 Public Homo sapiens 16 GSE1 22 109 92 CCDS HistoryNCBI Gene:23199Re-query CCDS DB by CCDS ID:10952.1Re-query CCDS DB by GeneID:23199See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 10952.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000253458.11 ENSP00000253458.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000253458.11Link to Ensembl Protein Viewer:ENSP00000253458.6Re-query CCDS DB by Nucleotide ID:ENST00000253458Re-query CCDS DB by Protein ID:ENSP00000253458
Original member Current member NCBI NM_014615.4 NP_055430.1 Accepted alive Link to Nucleotide Sequence:NM_014615.4Link to Protein Sequence:NP_055430.1Re-query CCDS DB by Nucleotide ID:NM_014615Re-query CCDS DB by Protein ID:NP_055430Link to BLAST:NP_055430.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_055430.1 1217 Q14687-1 1217 100% 0 0

Chromosomal Locations for CCDS 10952.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 85613392 85613398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85633914 85634132 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85648552 85648751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85654278 85654450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85654794 85654991 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85655726 85655917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85656343 85656665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85657277 85657604 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85661146 85661765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85662981 85663093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85663344 85663614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85665015 85665128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85665976 85666347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85668140 85668424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85670995 85671098 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85672405 85672539 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3654 nt):
ATGAAAGGCATGAGCCATGAGCCCAAGTCCCCTTCGCTAGGGATGCTTTCCACCGCGACCAGGACCACCG
CC
ACCGTCAACCCCCTCACCCCCTCGCCGCTCAATGGCGCCCTGGTGCCCAGCGGCAGCCCCGCCACCAG
C
AGCGCGCTGTCGGCCCAGGCCGCGCCATCCTCCAGCTTTGCCGCCGCGCTGCGCAAGCTCGCCAAACAG
GCG
GAGGAGCCCAGAGGGTCCTCACTGAGCAGCGAGTCGTCCCCCGTGTCCTCTCCGGCCACCAACCACA
GC
TCCCCCGCCAGCACACCCAAGCGCGTGCCCATGGGCCCTATCATCGTCCCCCCTGGGGGCCACAGCGT
G
CCCAGCACCCCCCCCGTGGTGACCATCGCTCCAACCAAAACCGTGAATGGTGTCTGGAGGAGTGAGAGC
CGG
CAGGATGCCGGCTCCAGGAGCAGCAGTGGAGGTCGGGAACGCCTCATTGTGGAGCCCCCGCTCCCTC
AG
GAGAAGGCAGGGGGACCAGCCATCCCCTCGCACCTGCTCAGCACCCCCTACCCCTTCGGCCTCTCCCC
C
AGCTCAGTTGTGCAGGATTCCCGCTTCCCGCCACTCAACCTCCAGCGGCCCGTGCACCACGTGGTGCCC
CCC
AGTACCGTGACCGAGGACTACCTGAGAAGCTTCCGGCCCTACCACACCACCGACGACCTCCGCATGT
CC
TCACTGCCTCCCCTCGGCCTGGACCCGGCCACTGCTGCAGCCTACTACCACCCCAGCTACCTGGCCCC
A
CACCCCTTCCCCCACCCGGCCTTCAGGATGGACGACTCCTACTGCCTGTCTGCCCTGAGGTCCCCGTTC
TAC
CCCATCCCCACCCCCGGCTCCCTGCCCCCACTGCACCCATCAGCGATGCACCTGCACCTCTCTGGGG
TC
CGCTACCCTCCCGAGCTCTCCCACTCATCCCTGGCAGCGCTGCACTCGGAGCGCATGTCTGGCCTCAG
C
GCGGAGAGGCTGCAGATGGACGAGGAGCTAAGGCGGGAGAGGGAGCGCGAGCGCGAGCGCGAGCGTGAG
CGT
GAGGCTGACCGCGAGCGGGAGAAGGAACGTGAGCGCGAACGCGAGAAGGAGCGCGAGCAAGAGAAGG
AG
CGTGAGCGTGAGAAGGAGCGCGAGCGCGAGCTGGAGCGCCAGCGGGAGCAGCGGGCCCGGGAGAAGGA
G
CTGCTGGCCGCCAAGGCCCTGGAGCCCAGCTTCCTGCCCGTGGCCGAGCTGCATGGGCTGCGTGGCCAT
GCC
ACTGAGGAGCGGGGCAAGCCCTCGGAGCAGCTGACCCCAACCCGAGCAGAGAAGCTGAAGGATGCCG
GC
CTGCAGGCGCCCAAGCCCGTCCAACACCCCTTGCATCCGGTGCCCACCCCACACCACACGGTGCCCAG
C
CTCATCTCCAACCATGGCATCTTCTCTCTGCCTAGCAGCAGTGCTGCCACAGCCCTGCTGATCCAGCGC
ACC
AATGAGGAGGAGAAGTGGCTGGCGCGGCAGCGGCGGCTGCGGCAGGAGAAGGAGGACCGGCAGTCTC
AG
GTGTCCGAGTTCCGGCAGCAGGTGCTGGAGCAGCACCTGGATATGGGCCGGCCCCCGGTGCCGGCGGA
G
GCAGAGCACAGGCCGGAGAGCACCACCAGGCCAGGACCAAACCGTCACGAGCCAGGTGGCCGTGACCCT
CCG
CAGCACTTTGGGGGGCCACCACCTCTGATTTCGCCCAAGCCCCAGCTCCATGCTGCACCCACGGCCC
TC
TGGAACCCCGTGTCCCTGATGGACAACACCTTGGAGACGCGGCGGGCCGAAAGCCACTCTCTGCACAG
C
CACCCGGCTGCATTTGAGCCCAGCCGCCAGGCAGCCGTGCCGCTGGTGAAGGTGGAGCGGGTCTTCTGC
CCG
GAGAAAGCAGAGGAGGGGCCACGGAAGCGTGAGCCTGCCCCTCTGGACAAGTACCAGCCACCTCCGC
CG
CCACCACGAGAGGGAGGGAGCCTGGAGCACCAGCCCTTCCTGCCCGGGCCCGGGCCCTTCCTGGCTGA
G
CTCGAGAAGTCCACCCAGACCATCCTGGGCCAGCAGCGGGCCTCCCTCCCACAGGCGGCCACCTTCGGG
GAG
CTCAGCGGACCCCTGAAGCCTGGCTCGCCCTACCGGCCCCCAGTGCCACGGGCCCCCGACCCTGCCT
AC
ATCTATGATGAGTTCCTGCAGCAGCGCCGGAGGCTGGTCAGCAAGCTGGACCTGGAGGAGCGCAGGCG
G
CGGGAGGCCCAGGAGAAAGGGTACTACTACGACCTCGATGACTCTTACGACGAGAGCGATGAGGAGGAG
GTC
AGGGCCCACCTCCGTTGCGTGGCCGAGCAGCCGCCCCTCAAACTGGACACGTCCTCTGAGAAGCTAG
AG
TTTTTGCAACTTTTTGGCTTGACCACCCAACAGCAGAAGGAGGAATTGGTGGCCCAGAAGCGGAGGAA
G
CGGCGGAGGATGCTGCGAGAGAGAAGCCCGTCGCCCCCAACAATTCAGAGCAAGCGGCAGACGCCTTCA
CCG
AGACTGGCGCTGTCTACCCGCTACAGCCCTGATGAGATGAACAACAGTCCCAACTTCGAAGAAAAGA
AG
AAGTTCCTGACCATCTTCAACCTGACCCACATCAGCGCTGAGAAGAGGAAAGACAAAGAGAGACTTGT
T
GAAATGCTCCGTGCCATGAAGCAGAAGGCACTGTCAGCAGCAGTGGCCGACTCCTTGACAAACTCTCCG
AGG
GACAGTCCTGCCGTCTCCCTGAGTGAACCAGCCACGCAGCAAGCCTCTCTGGATGTGGAGAAGCCGG
TT
GGTGTTGCTGCTTCCTTGTCTGACATCCCAAAGGCCGCGGAGCCTGGGAAGCTGGAACAGGTCCGGCC
C
CAGGAGCTGTCGAGAGTCCAGGAGCTAGCTCCTGCCAGCGGGGAGAAGGCCAGGCTGAGCGAGGCCCCT
GGA
GGCAAAAAGAGTCTGAGCATGCTTCACTATATCCGGGGCGCTGCACCCAAGGACATTCCTGTGCCGC
TG
TCCCACAGCACCAATGGGAAGAGCAAGCCGTGGGAGCCCTTTGTGGCAGAAGAGTTTGCACATCAGTT
C
CACGAGTCAGTGCTGCAGTCCACCCAGAAGGCCCTGCAGAAGCATAAAGGGAGCGTGGCTGTGCTGTCT
GCA
GAGCAGAACCACAAGGTTGACACGTCCGTCCACTACAACATTCCTGAGCTGCAGTCCTCCAGCCGCG
CC
CCTCCACCCCAGCACAATGGGCAGCAGGAGCCCCCCACTGCAAGGAAGGGCCCCCCAACCCAGGAGTT
G
GACCGGGACTCGGAGGAGGAGGAAGAGGAGGATGATGAAGATGGAGAAGATGAGGAGGAAGTCCCCAAG
CGC
AAGTGGCAAGGGATCGAGGCCGTTTTTGAAGCTTACCAGGAACACATAGAAGAGCAAAATCTGGAGC
GG
CAGGTGTTACAGACACAATGTAGACGACTGGAGGCCCGGCACTACAGCCTCAGCCTGACGGCAGAGCA
G
CTCTCCCACAGCGTGGCGGAGTTGAGGAGCCAGAAACAGAAGATGGTCTCAGAAAGGGAGCGGCTCCAG
GCA
GAACTGGACCACTTACGAAAGTGCCTTGCCTTGCCTGCAATGCACTGGCCTAGGGGCTACCTGAAGG
GA
TATCCCAGGTGA


Translation (1217 aa):
MKGMSHEPKSPSLGMLSTATRTTATVNPLTPSPLNGALVPSGSPATSSALSAQAAPSSSFAAALRKLAKQ
A
EEPR
GSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPGGHSVPSTPPVVTIAPTKTVNGVWRSES
R
Q
DAGSRSSSGGRERLIVEPPLPQEKAGGPAIPSHLLSTPYPFGLSPSSVVQDSRFPPLNLQRPVHHVVP
P
STVTEDYLRSFRPYHTTDDLRMSSLPPLGLDPATAAAYYHPSYLAPHPFPHPAF
RMDDSYCLSALRSPF
Y
PIPTPGSLPPLHPSAMHLHLSGVRYPPELSHSSLAALHSERMSGLSAE
RLQMDEELRRERERERERERE
R
EADREREKEREREREKEREQEKEREREKERERELERQREQRAREKELLAAKALEPSFLPVAELHGLRGH
A
TEERGKPSEQLTPTRA
EKLKDAGLQAPKPVQHPLHPVPTPHHTVPSLISNHGIFSLPSSSAATALLIQR
T
NEEEKWLARQRRLRQEKEDRQSQVSEFRQQVLEQHLDMGRPPVPAEAEHRPESTT
RPGPNRHEPGGRDP
P
QHFGGPPPLISPKPQLHAAPTALWNPVSLMDNTLETRRAESHSLHSHPAAFEPSRQAAVPLVKVERVFC
P
EKAEEGPRKREPAPLDKYQPPPPPPREGGSLEHQPFLPGPGPFLAELEKSTQTILGQQRASLPQAATFG
E
LSGPLKPGSPYRPPVPRAPDPAYIYDEFLQQRRRLVSKLDLEERRRREAQEK
GYYYDLDDSYDESDEEE
V
RAHLRCVAEQPPLKLDTSSE
KLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPTIQSKRQTPS
P
RLALSTRYSPDEMNNSPNFEEKKKFLTIFNLTHISAEKRK
DKERLVEMLRAMKQKALSAAVADSLTNSP
R
DSPAVSLS
EPATQQASLDVEKPVGVAASLSDIPKAAEPGKLEQVRPQELSRVQELAPASGEKARLSEAP
G
GKKSLSMLHYIRGAAPKDIPVPLSHSTNGKSKPWEPFVAEEFAHQFHESVLQSTQKALQKHK
GSVAVLS
A
EQNHKVDTSVHYNIPELQSSSRAPPPQHNGQQEPPTARKGPPTQELDRDSEEEEEEDDEDGEDEEEVPK
R
KWQGIEAVFEAYQEHIE
EQNLERQVLQTQCRRLEARHYSLSLTAEQLSHSVAELRSQKQKMVSERERLQ
A
ELDHLRKCLALPAMHWPRGYLKGYPR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser