NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS10789.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10789.2 Public Homo sapiens 16 KIFC3 22 109 92 CCDS HistoryNCBI Gene:3801Re-query CCDS DB by CCDS ID:10789.2Re-query CCDS DB by GeneID:3801See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 10789.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000379655.8 ENSP00000368976.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379655.8Link to Ensembl Protein Viewer:ENSP00000368976.4Re-query CCDS DB by Nucleotide ID:ENST00000379655Re-query CCDS DB by Protein ID:ENSP00000368976
Original member NCBI NM_005550.3 NP_005541.3 Updated not alive Link to Nucleotide Sequence:NM_005550.3Link to Protein Sequence:NP_005541.3Re-query CCDS DB by Nucleotide ID:NM_005550Re-query CCDS DB by Protein ID:NP_005541
Current member NCBI NM_005550.4 NP_005541.3 Accepted alive Link to Nucleotide Sequence:NM_005550.4Link to Protein Sequence:NP_005541.3Re-query CCDS DB by Nucleotide ID:NM_005550Re-query CCDS DB by Protein ID:NP_005541Link to BLAST:NP_005541.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005541.3 833 Q9BVG8-3 833 100% 0 0

Chromosomal Locations for CCDS 10789.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 57758884 57758909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57759728 57759836 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57760282 57760416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57760726 57760955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57761042 57761171 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57761413 57761536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57762140 57762270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57764143 57764247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57765459 57765640 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57766874 57766985 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57769595 57769725 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57769808 57769955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57770527 57770700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57771198 57771437 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57771543 57771686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57772223 57772288 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57794999 57795141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 57798072 57798243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2502 nt):
ATGGTCCCCTCTCGCAGGACGTGGAACCTGGGAGCCACGCCCTCGCTGCGGGGCCTGTGGAGAGTGGGCC
GG
GCCCCGGAGCCCGAGCCGGGGATGGCTCGCCCCGCCCCAGCCCCAGCCAGCCCGGCCGCCCGCCCTTT
C
CCACACACCGGCCCGGGGAGGTTGAGAACTGGGCGTGGAAAAGATACCCCAGTCTGCGGTGACGAGGAC
TCC
AGTGCCCGAAGTGCAGCTCGCCCAGCCCTAGCTCAGTGCCGAGCCCTTAGCGTGGACTGGGCTGGCC
CC
GGAAGCCCCCACGGGCTCTACCTGACCCTGCAGGTAGAACACCTGAAGGAGAAGCTCATTAGCCAGGC
C
CAGGAAGTGAGCCGACTGCGATCTGAGCTGGGGGGCACCGACTTGGAGAAGCACCGGGACCTGCTGATG
GTG
GAGAATGAGCGACTGAGGCAGGAGATGCGGCGCTGTGAGGCCGAGCTGCAAGAGCTGCGCACAAAGC
CA
GCAGGTCCCTGCCCAGGTTGTGAGCACAGCCAGGAGAGCGCCCAGCTCCGTGACAAGCTGTCCCAGCT
G
CAGCTGGAGATGGCGGAAAGCAAAGGCATGCTGTCAGAGCTGAACCTAGAGGTGCAGCAGAAGACCGAC
CGG
CTGGCTGAGGTGGAGCTGCGACTCAAGGACTGCCTGGCTGAGAAGGCACAGGAGGAGGAGCGGCTTA
GT
CGGCGCCTGCGTGACAGCCACGAGACCATTGCCAGCCTGCGGGCCCAGTCCCCACCTGTCAAGTATGT
C
ATCAAGACAGTGGAGGTGGAGTCGTCCAAGACCAAGCAGGCCCTCAGCGAGTCCCAGGCCCGGAACCAG
CAC
CTGCAGGAGCAGGTGGCTATGCAGAGGCAGGTGCTGAAGGAGATGGAACAGCAGCTGCAGAGCTCAC
AC
CAGCTGACCGCGCGGCTCCGGGCGCAGATTGCCATGTACGAGTCAGAGCTGGAGCGGGCCCATGGGCA
G
ATGCTGGAGGAGATGCAGTCCCTGGAAGAGGACAAGAACCGGGCCATTGAGGAGGCCTTTGCCAGAGCC
CAG
GTGGAGATGAAGGCTGTGCACGAGAATCTAGCAGGCGTCCGGACCAACTTGCTGACCTTGCAGCCGG
CA
CTGCGGACCCTCACCAACGACTACAATGGGCTCAAGCGGCAGGTGCGCGGCTTCCCACTGCTGCTGCA
G
GAGGCCCTCAGGAGTGTCAAGGCCGAGATAGGCCAGGCCATCGAGGAGGTCAACAGCAACAACCAGGAG
CTG
CTGCGCAAGTACCGCCGCGAGCTGCAGCTGCGTAAGAAGTGCCACAATGAGCTCGTGCGGCTGAAAG
GG
AACATCCGAGTGATTGCTCGTGTCCGGCCAGTCACCAAAGAGGATGGGGAAGGACCTGAGGCCACCAA
T
GCTGTGACTTTCGATGCCGACGACGACTCCATCATCCACCTGCTGCACAAGGGCAAGCCTGTGTCCTTC
GAG
CTGGACAAGGTCTTCTCCCCACAGGCCTCGCAGCAGGACGTGTTCCAGGAGGTGCAGGCCCTGGTCA
CC
TCTTGCATTGATGGCTTCAATGTCTGCATCTTTGCGTACGGCCAGACGGGCGCCGGCAAGACGTACAC
G
ATGGAGGGGACCGCTGAGAACCCAGGTATCAACCAGCGGGCCCTGCAGCTGCTCTTCTCCGAGGTGCAG
GAG
AAGGCGTCTGACTGGGAGTACACCATCACCGTCAGCGCTGCGGAGATCTACAATGAGGTCCTCAGGG
AC
CTGCTAGGGAAAGAGCCTCAGGAAAAACTGGAGATCCGGCTGTGCCCAGACGGCAGTGGGCAGCTGTA
T
GTACCAGGGCTGACTGAGTTCCAAGTGCAGAGCGTGGACGACATCAACAAGGTGTTTGAGTTTGGCCAC
ACT
AATCGCACGACCGAGTTCACCAACCTGAACGAGCACAGCTCCCGCTCGCACGCGCTGCTCATCGTGA
CG
GTGCGAGGCGTGGACTGCAGCACAGGCCTCCGCACCACGGGGAAGCTGAACCTGGTGGACTTGGCTGG
C
TCGGAGCGCGTGGGCAAGTCGGGGGCCGAGGGCAGCCGCCTGCGGGAGGCGCAGCACATCAACAAGTCG
CTG
TCGGCTCTGGGGGACGTCATTGCTGCCCTGCGCTCCCGCCAGGGCCACGTGCCCTTCCGCAACTCCA
AG
CTCACCTACCTGCTGCAGGATTCGCTTAGTGGTGACAGCAAGACCCTCATGGTGGTACAGGTGTCCCC
C
GTGGAGAAGAACACTAGCGAGACGCTCTATTCCCTCAAGTTTGCTGAGAGGGTGCGCTCTGTGGAGCTG
GGG
CCTGGGCTACGCAGGGCAGAGCTTGGGTCCTGGTCAAGCCAGGAGCATCTAGAGTGGGAGCCGGCTT
GT
CAGACGCCACAGCCCTCGGCACGGGCCCACTCAGCCCCCAGCTCTGGGACCAGTAGCCGCCCTGGATC
C
ATCCGGAGGAAGCTGCAGCCCTCGGGGAAGTCGCGGCCACTGCCTGTGTGA


Translation (833 aa):
MVPSRRTWNLGATPSLRGLWRVGRAPEPEPGMARPAPAPASPAARPFPHTGPGRLRTGRGKDTPVCGDED
S
SARSAARPALAQCRALSVDWAGPGSPHGLYLTLQ
VEHLKEKLISQAQEVSRLRSELGGTDLEKHRDLLM
V
ENERLRQEMRRCEAELQELRTKPAGPCPGCEHSQ
ESAQLRDKLSQLQLEMAESKGMLSELNLEVQQKTD
R
LAEVELRLKDCLAEKAQEEERLSRRLRDSHETIASLRAQSPPVK
YVIKTVEVESSKTKQALSESQARNQ
H
LQEQVAMQRQVLKEMEQQLQSSHQLTARLRAQ
IAMYESELERAHGQMLEEMQSLEEDKNRAIEEAFARA
Q
VEMKAVHENLA
GVRTNLLTLQPALRTLTNDYNGLKRQVRGFPLLLQEALRSVKAEIGQAIEEVNSNNQE
L
LRKYRRELQLRKKCHNELVRLK
GNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSF
E
LDKVFSPQASQQD
VFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENPGINQRALQLLFSEVQ
E
KASDWEYTITVSAAEIYNEVL
RDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGH
T
NRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTT
GKLNLVDLAGSERVGKSGAEGSRLREAQHINKS
L
SALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQ
VSPVEKNTSETLYSLKFAERVRSVEL
G
PGLRRAELGSWSSQEHLE
WEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser