NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10017.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10017.1 Public Homo sapiens 15 SNRPN 20 108 85 CCDS HistoryNCBI Gene:6638Re-query CCDS DB by CCDS ID:10017.1Re-query CCDS DB by GeneID:6638See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10017.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000346403 ENSP00000306223 Accepted alive Link to Ensembl Transcript Viewer:ENST00000346403Link to Ensembl Protein Viewer:ENSP00000306223Re-query CCDS DB by Nucleotide ID:ENST00000346403Re-query CCDS DB by Protein ID:ENSP00000306223
Original member Current member EBI,WTSI ENST00000390687 ENSP00000375105 Accepted alive Link to Ensembl Transcript Viewer:ENST00000390687Link to Ensembl Protein Viewer:ENSP00000375105Re-query CCDS DB by Nucleotide ID:ENST00000390687Re-query CCDS DB by Protein ID:ENSP00000375105
Original member Current member EBI,WTSI ENST00000400097 ENSP00000382969 Accepted alive Link to Ensembl Transcript Viewer:ENST00000400097Link to Ensembl Protein Viewer:ENSP00000382969Re-query CCDS DB by Nucleotide ID:ENST00000400097Re-query CCDS DB by Protein ID:ENSP00000382969
Original member Current member EBI,WTSI ENST00000400100 ENSP00000382972 Accepted alive Link to Ensembl Transcript Viewer:ENST00000400100Link to Ensembl Protein Viewer:ENSP00000382972Re-query CCDS DB by Nucleotide ID:ENST00000400100Re-query CCDS DB by Protein ID:ENSP00000382972
Original member Current member EBI,WTSI ENST00000577565 ENSP00000463458 Accepted alive Link to Ensembl Transcript Viewer:ENST00000577565Link to Ensembl Protein Viewer:ENSP00000463458Re-query CCDS DB by Nucleotide ID:ENST00000577565Re-query CCDS DB by Protein ID:ENSP00000463458
Original member Current member EBI,WTSI OTTHUMT00000251254 OTTHUMP00000159463 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000251254Link to Vega Protein Viewer:OTTHUMP00000159463Re-query CCDS DB by Nucleotide ID:OTTHUMT00000251254Re-query CCDS DB by Protein ID:OTTHUMP00000159463
Original member Current member EBI,WTSI OTTHUMT00000413849 OTTHUMP00000246279 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000413849Link to Vega Protein Viewer:OTTHUMP00000246279Re-query CCDS DB by Nucleotide ID:OTTHUMT00000413849Re-query CCDS DB by Protein ID:OTTHUMP00000246279
Original member Current member EBI,WTSI OTTHUMT00000413850 OTTHUMP00000246280 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000413850Link to Vega Protein Viewer:OTTHUMP00000246280Re-query CCDS DB by Nucleotide ID:OTTHUMT00000413850Re-query CCDS DB by Protein ID:OTTHUMP00000246280
Original member Current member EBI,WTSI OTTHUMT00000446297 OTTHUMP00000261390 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000446297Link to Vega Protein Viewer:OTTHUMP00000261390Re-query CCDS DB by Nucleotide ID:OTTHUMT00000446297Re-query CCDS DB by Protein ID:OTTHUMP00000261390
Original member Current member EBI,WTSI OTTHUMT00000446299 OTTHUMP00000261392 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000446299Link to Vega Protein Viewer:OTTHUMP00000261392Re-query CCDS DB by Nucleotide ID:OTTHUMT00000446299Re-query CCDS DB by Protein ID:OTTHUMP00000261392
Original member NCBI NM_003097.4 NP_003088.1 Updated not alive Link to Nucleotide Sequence:NM_003097.4Link to Protein Sequence:NP_003088.1Re-query CCDS DB by Nucleotide ID:NM_003097Re-query CCDS DB by Protein ID:NP_003088
Current member NCBI NM_003097.5 NP_003088.1 Accepted alive Link to Nucleotide Sequence:NM_003097.5Link to Protein Sequence:NP_003088.1Re-query CCDS DB by Nucleotide ID:NM_003097Re-query CCDS DB by Protein ID:NP_003088Link to BLAST:NP_003088.1
Original member NCBI NM_022805.3 NP_073716.1 Updated not alive Link to Nucleotide Sequence:NM_022805.3Link to Protein Sequence:NP_073716.1Re-query CCDS DB by Nucleotide ID:NM_022805Re-query CCDS DB by Protein ID:NP_073716
Current member NCBI NM_022805.4 NP_073716.1 Accepted alive Link to Nucleotide Sequence:NM_022805.4Link to Protein Sequence:NP_073716.1Re-query CCDS DB by Nucleotide ID:NM_022805Re-query CCDS DB by Protein ID:NP_073716Link to BLAST:NP_073716.1
Original member NCBI NM_022806.3 NP_073717.1 Updated not alive Link to Nucleotide Sequence:NM_022806.3Link to Protein Sequence:NP_073717.1Re-query CCDS DB by Nucleotide ID:NM_022806Re-query CCDS DB by Protein ID:NP_073717
Current member NCBI NM_022806.4 NP_073717.1 Accepted alive Link to Nucleotide Sequence:NM_022806.4Link to Protein Sequence:NP_073717.1Re-query CCDS DB by Nucleotide ID:NM_022806Re-query CCDS DB by Protein ID:NP_073717Link to BLAST:NP_073717.1
Original member NCBI NM_022807.3 NP_073718.1 Updated not alive Link to Nucleotide Sequence:NM_022807.3Link to Protein Sequence:NP_073718.1Re-query CCDS DB by Nucleotide ID:NM_022807Re-query CCDS DB by Protein ID:NP_073718
Current member NCBI NM_022807.4 NP_073718.1 Accepted alive Link to Nucleotide Sequence:NM_022807.4Link to Protein Sequence:NP_073718.1Re-query CCDS DB by Nucleotide ID:NM_022807Re-query CCDS DB by Protein ID:NP_073718Link to BLAST:NP_073718.1
Original member NCBI NM_022808.3 NP_073719.1 Updated not alive Link to Nucleotide Sequence:NM_022808.3Link to Protein Sequence:NP_073719.1Re-query CCDS DB by Nucleotide ID:NM_022808Re-query CCDS DB by Protein ID:NP_073719
Current member NCBI NM_022808.4 NP_073719.1 Accepted alive Link to Nucleotide Sequence:NM_022808.4Link to Protein Sequence:NP_073719.1Re-query CCDS DB by Nucleotide ID:NM_022808Re-query CCDS DB by Protein ID:NP_073719Link to BLAST:NP_073719.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003088.1 240 P63162-1 240 100% 0 0
NP_073716.1 240 P63162-1 240 100% 0 0
NP_073717.1 240 P63162-1 240 100% 0 0
NP_073718.1 240 P63162-1 240 100% 0 0
NP_073719.1 240 P63162-1 240 100% 0 0

Chromosomal Locations for CCDS 10017.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 24974454 24974456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 24975358 24975509 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 24976305 24976416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 24976877 24977029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 24977778 24977916 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 24978193 24978318 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 24978407 24978444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (723 nt):
ATGACTGTTGGCAAGAGTAGCAAGATGCTGCAGCACATTGACTATAGAATGAGATGTATCCTGCAAGATG
GC
CGAATCTTCATTGGCACCTTTAAGGCTTTTGACAAGCATATGAATTTGATCCTCTGTGATTGTGATGA
G
TTCAGAAAGATCAAGCCAAAGAATGCGAAGCAACCAGAGCGTGAAGAAAAGCGGGTTTTGGGTCTGGTG
TTG
CTGCGTGGGGAGAACTTGGTATCCATGACTGTGGAGGGGCCACCCCCCAAAGATACTGGCATTGCTC
GG
GTACCACTTGCTGGAGCTGCTGGAGGCCCTGGGGTTGGTAGGGCAGCTGGTAGAGGAGTACCAGCTGG
T
GTGCCAATTCCCCAGGCCCCTGCTGGATTGGCAGGCCCTGTCCGAGGAGTTGGGGGACCATCCCAGCAG
GTA
ATGACTCCACAGGGAAGAGGCACTGTAGCAGCTGCTGCTGTTGCTGCGACTGCCAGTATTGCTGGAG
CC
CCAACACAGTACCCACCAGGACGGGGCACTCCGCCCCCACCCGTCGGCAGAGCAACCCCACCTCCAGG
C
ATTATGGCTCCTCCACCTGGTATGAGACCACCCATGGGCCCACCAATTGGGCTTCCCCCTGCTCGAGGG
ACG
CCAATAGGCATGCCGCCTCCGGGAATGAGACCCCCTCCACCAGGCATTAGAGGTCCACCTCCCCCAG
GA
ATGCGTCCACCAAGACCTTAG


Translation (240 aa):
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLV
L
LRGENLVSMTVEGPPPKD
TGIARVPLAGAAGGPGVGRAAGRGVPAGVPIPQAPAGLAGPVRGVGGPSQQ
V
MTPQGRGTVAAAAVAATASIAGAPTQYPPGRGTPPPPVGRATPPP
GIMAPPPGMRPPMGPPIGLPPARG
T
PIGMPPPGMRPPPPGIR
GPPPPGMRPPRP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser