NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS9890.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9890.1 Public Homo sapiens 14 NRDE2 24 110 108 CCDS HistoryNCBI Gene:55051Re-query CCDS DB by CCDS ID:9890.1Re-query CCDS DB by GeneID:55051See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9890.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000354366.8 ENSP00000346335.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000354366.8Link to Ensembl Protein Viewer:ENSP00000346335.3Re-query CCDS DB by Nucleotide ID:ENST00000354366Re-query CCDS DB by Protein ID:ENSP00000346335
Original member Current member NCBI NM_017970.4 NP_060440.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_017970.4Link to Protein Sequence:NP_060440.2Re-query CCDS DB by Nucleotide ID:NM_017970Re-query CCDS DB by Protein ID:NP_060440Link to BLAST:NP_060440.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_060440.2 1164 Q9H7Z3 1164 100% 0 0

Chromosomal Locations for CCDS 9890.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 90278336 90278461 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90279062 90279133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90286354 90286492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90288217 90289145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90290221 90290607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90292697 90292872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90298260 90298380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90301239 90301372 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90302720 90303125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90303935 90304382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90312394 90312543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90316578 90316811 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90318005 90318113 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 90331841 90331904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3495 nt):
ATGGCGCTGTTCCCAGCCTTTGCGGGGCTTAGTGAGGCTCCCGATGGCGGGAGCTCCAGGAAAGAGTTAG
AC
TGGCTGAGCAACCCAAGCTTTTGTGTTGGATCCATAACGTCCCTGAGCCAACAAACTGAAGCAGCTCC
A
GCCCATGTTTCTGAAGGGTTACCGCTGACAAGGAGTCATCTGAAATCAGAGTCTTCAGATGAAAGTGAC
ACT
AACAAAAAGCTCAAACAAACAAGTAGAAAAAAGAAGAAAGAGAAAAAGAAAAAAAGGAAGCATCAGC
AT
CATAAGAAAACAAAGAGGAAGCATGGGCCGTCGAGTAGCAGCAGGTCTGAGACAGACACCGATTCTGA
A
AAGGACAAACCTTCCAGAGGCGTTGGAGGCAGTAAAAAGGAATCTGAGGAACCGAATCAAGGAAATAAT
GCT
GCAGCTGATACTGGACATCGCTTTGTTTGGCTTGAGGACATTCAGGCTGTGACGGGAGAAACCTTCA
GA
ACAGATAAGAAACCAGATCCTGCGAACTGGGAGTACAAGTCTCTCTACCGAGGGGATATAGCAAGATA
C
AAGAGGAAAGGAGACTCCTGCCTTGGCATTAACCCTAAGAAGCAGTGCATATCTTGGGAAGGGACTTCC
ACA
GAGAAGAAGCATTCACGCAAGCAGGTTGAACGCTATTTTACTAAGAAGAGTGTGGGATTAATGAACA
TC
GATGGAGTTGCCATTAGCAGTAAAACTGAACCTCCCTCATCTGAGCCCATCTCCTTTATACCAGTGAA
G
GACTTGGAAGATGCGGCTCCTGTTACAACCTGGTTGAATCCTCTGGGGATTTATGATCAGTCAACCACA
CAT
TGGCTACAAGGACAGGGTCCTCCAGAGCAGGAATCAAAGCAGCCAGACGCACAGCCAGACAGCGAGA
GT
GCGGCTCTCAAGGCCAAGGTGGAGGAGTTTAACAGGAGGGTGCGGGAGAATCCTCGGGATACGCAGCT
G
TGGATGGCATTTGTTGCTTTTCAGGACGAGGTCATGAAAAGTCCTGGCCTGTATGCCATCGAGGAAGGA
GAG
CAGGAAAAGCGAAAGAGGTCCCTGAAGCTCATTCTGGAGAAGAAGCTGGCCATTCTGGAGCGGGCCA
TT
GAGAGCAACCAGAGCAGTGTGGATCTGAAACTGGCCAAGCTGAAGCTCTGCACAGAGTTCTGGGAGCC
C
TCCACTCTGGTCAAAGAGTGGCAGAAACTGATATTTTTGCATCCCAATAATACAGCCCTTTGGCAGAAA
TAC
CTTTTATTTTGCCAGAGCCAGTTTAGTACCTTTTCGATATCAAAAATTCACAGTCTTTATGGAAAAT
GC
TTGAGCACTTTGTCTGCTGTTAAGGACGGCAGCATCTTATCTCACCCTGCGTTGCCTGGCACGGAAGA
G
GCCATGTTTGCACTCTTTCTTCAGCAGTGCCACTTTCTGCGGCAGGCTGGCCACTCTGAGAAGGCCATC
TCA
TTGTTCCAGGCCATGGTGGACTTCACCTTCTTCAAACCCGACAGCGTGAAAGATCTGCCTACCAAAG
GA
CAGGTGGAATTCTTTGAACCCTTTTGGGACAGTGGAGAGCCCCGGGCTGGGGAGAAGGGAGCCCGAGG
C
TGGAAGGCGTGGATGCACCAGCAGGAACGAGGTGGCTGGGTGGTCATCAACCCAGATGAGGATGACGAT
GAA
CCAGAAGAGGATGACCAGGAAATAAAAGATAAGACTCTGCCCAGGTGGCAGATCTGGCTTGCTGCTG
AG
CGTTCCCGTGACCAGAGGCACTGGCGGCCCTGGCGCCCTGATAAGACCAAGAAGCAAACCGAGGAAGA
C
TGTGAGGATCCCGAGAGACAGGTGTTGTTTGATGATATTGGGCAATCTTTGATCAGACTTTCCAGCCAT
GAT
CTTCAGTTCCAGCTGGTGGAGGCCTTCCTGCAGTTCTTGGGTGTGCCTTCTGGCTTTACTCCTCCAG
CC
TCCTGTCTTTATCTGGCCATGGATGAGAACAGCATCTTTGATAATGGACTTTATGATGAAAAGCCCTT
G
ACTTTTTTCAACCCTTTGTTTTCTGGGGCTAGCTGTGTTGGCCGCATGGATAGGTTGGGCTATCCTCGC
TGG
ACCAGGGGTCAGAACCGAGAGGGCGAGGAGTTCATCCGCAATGTCTTCCACCTTGTCATGCCTTTAT
TT
TCAGGCAAAGAGAAGTCCCAGCTCTGCTTCTCCTGGTTACAGTATGAGATTGCAAAGGTCATTTGGTG
C
CTGCACACTAAAAACAAGAAGAGATTAAAGTCTCAAGGGAAGAACTGCAAAAAACTAGCCAAGAATCTC
CTT
AAGGAGCCAGAAAACTGCAACAACTTTTGCCTGTGGAAGCAGTATGCACATCTGGAGTGGTTGCTTG
GC
AACACGGAGGATGCCAGAAAAGTTTTTGACACAGCACTTGGCATGGCAGGAAGCAGAGAACTGAAAGA
C
TCTGACCTCTGTGAGCTCAGTCTGCTCTATGCTGAGCTGGAGGTGGAGCTGTCGCCAGAAGTGAGAAGG
GCT
GCCACAGCTCGAGCTGTTCACATATTAACCAAGCTGACTGAGAGCAGCCCCTATGGGCCCTACACTG
GA
CAGGTGTTGGCTGTTCACATTTTGAAAGCGCGAAAGGCTTATGAGCACGCACTGCAGGACTGTTTGGG
T
GACAGCTGTGTCTCCAATCCAGCTCCCACCGATTCCTGTAGCCGCCTAATTAGCCTGGCTAAATGCTTC
ATG
CTCTTCCAGTATTTGACCATAGGGATTGATGCTGCTGTGCAGATATACGAACAGGTGTTTGCAAAAC
TG
AACAGTTCTGTTTTCCCAGAAGGCTCTGGCGAGGGGGACAGTGCCAGCTCCCAGAGTTGGACCAGTGT
T
CTCGAAGCCATCACACTGATGCACACGAGCCTGCTGAGATTCCACATGAAAGTGAGTGTTTACCCGCTG
GCC
CCTCTGCGAGAGGCACTCTCACAGGCTTTAAAGTTGTATCCAGGCAACCAGGTTCTTTGGAGGTCCT
AT
GTACAGATTCAGAATAAGTCCCACAGTGCCAGCAAAACCAGGAGATTTTTTGACACAATCACCAGGTC
T
GCCAAACCCTTGGAGCCTTGGTTGTTTGCAATTGAAGCTGAGAAACTGAGGAAGAGACTGGTGGAAACT
GTC
CAGAGGTTAGACGGTAGAGAGATCCACGCCACAATTCCTGAGACCGGCTTAATGCATCGGATCCAAG
CC
CTGTTTGAAAATGCCATGCGCAGCGACAGTGGCAGCCAGTGCCCCTTGCTGTGGAGGATGTATTTGAA
C
TTTCTGGTTTCCTTAGGAAATAAAGAAAGAAGCAAAGGTGTATTCTACAAAGCACTTCAGAATTGCCCT
TGG
GCAAAGGTGTTGTACCTGGACGCCGTGGAGTATTTCCCCGATGAGATGCAGGAGATCCTGGACCTGA
TG
ACTGAGAAGGAGCTCCGGGTGCGCCTGCCGCTGGAGGAGCTGGAGCTGCTGCTGGAGGATTAG


Translation (1164 aa):
MALFPAFAGLSEAPDGGSSRKELDWLSNPSFCVGSITSLSQQTEAAPAHVSEGLPLTRSHLKSESSDESD
T
NKKLKQTSRKKKKEKKKKRKHQHHKKTKRKHGPSSSSRSETDTDSEKDKPSRGVGGSKKESEEP
NQGNN
A
AADTGHRFVWLEDIQAVTGETFRTDKKPDPANWEYKSLYRGDIA
RYKRKGDSCLGINPKKQCISWEGTS
T
EKKHSRKQVERYFTKKSVGLMNIDGVAISSKTEPPSSEPISFIPVKDLEDAAPVTTWLNPLGIYDQSTT
H
WLQGQGPPEQESKQPDAQPDSESAALKAKVEEFNRRVRENPRDTQLWMAFVAFQ
DEVMKSPGLYAIEEG
E
QEKRKRSLKLILEKKLAILERAIESNQSSVDLKLAKLKLCTEFWEPSTLVKEWQKLIFLHPNNTALWQK
Y
LLFCQSQFSTFSISKIHSLYGKCLSTLSAVKDGSILSHPALPGTEEAMF
ALFLQQCHFLRQAGHSEKAI
S
LFQAMVDFTFFKPDSVKDLPTKGQ
VEFFEPFWDSGEPRAGEKGARGWKAWMHQQERGGWVVINPDEDDD
E
PEEDDQEIKDKTLPRWQIWLAAERSRDQRHWRPWRPDKTKKQTEEDCEDPERQ
VLFDDIGQSLIRLSSH
D
LQFQLVEAFLQFLGVPSGFTPPASCLYLAMDENSIFDNGLYDEKPLTFFNPLFSGASCVGRMDRLGYPR
W
TRGQNREGEEFIRNVFHLVMPLFSGKEKSQLCFSWLQYEIAK
VIWCLHTKNKKRLKSQGKNCKKLAKNL
L
KEPENCNNFCLWKQYAHLEWLLGNTEDARKVFDTALGMAGSRELKDSDLCELSLLYAELEVELSPEVRR
A
ATARAVHILTKLTESSPYGPYTGQVLAVHILKARKAYEHALQDCLGDSCVSNPAPTDSCSRLISLAKCF
M
LFQYLTIGIDAAVQIYEQVFAKLNSSVFPEGSGEGDSASSQSWTSVLEAITLMHTSLLRFHMKVSVYPL
A
PLREALSQALKLYPGNQVLWRSYVQIQNKSHSASKTRRFFDTITRSAKPLEPWLFAIEAEKLRKRLVET
V
Q
RLDGREIHATIPETGLMHRIQALFENAMRSDSGSQCPLLWRMYLNFLVSLGNKERSKGVFYKALQNCP
W
AK
VLYLDAVEYFPDEMQEILDLMTEKELRVRLPLEELELLLED



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser