NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS9838.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9838.1 Public Homo sapiens 14 ACYP1 22 109 92 CCDS HistoryNCBI Gene:97Re-query CCDS DB by CCDS ID:9838.1Re-query CCDS DB by GeneID:97See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9838.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000238618.7 ENSP00000238618.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000238618.7Link to Ensembl Protein Viewer:ENSP00000238618.3Re-query CCDS DB by Nucleotide ID:ENST00000238618Re-query CCDS DB by Protein ID:ENSP00000238618
Original member Current member EBI ENST00000555694.5 ENSP00000451581.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555694.5Link to Ensembl Protein Viewer:ENSP00000451581.1Re-query CCDS DB by Nucleotide ID:ENST00000555694Re-query CCDS DB by Protein ID:ENSP00000451581
Original member NCBI NM_001107.4 NP_001098.1 Updated not alive Link to Nucleotide Sequence:NM_001107.4Link to Protein Sequence:NP_001098.1Re-query CCDS DB by Nucleotide ID:NM_001107Re-query CCDS DB by Protein ID:NP_001098
Current member NCBI NM_001107.5 NP_001098.1 Accepted alive Link to Nucleotide Sequence:NM_001107.5Link to Protein Sequence:NP_001098.1Re-query CCDS DB by Nucleotide ID:NM_001107Re-query CCDS DB by Protein ID:NP_001098Link to BLAST:NP_001098.1
Original member NCBI NM_001302616.1 NP_001289545.1 Updated not alive Link to Nucleotide Sequence:NM_001302616.1Link to Protein Sequence:NP_001289545.1Re-query CCDS DB by Nucleotide ID:NM_001302616Re-query CCDS DB by Protein ID:NP_001289545
Current member NCBI NM_001302616.2 NP_001289545.1 Accepted alive Link to Nucleotide Sequence:NM_001302616.2Link to Protein Sequence:NP_001289545.1Re-query CCDS DB by Nucleotide ID:NM_001302616Re-query CCDS DB by Protein ID:NP_001289545Link to BLAST:NP_001289545.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001098.1 99 P07311-1 99 100% 0 0
NP_001289545.1 99 P07311-1 99 100% 0 0

Chromosomal Locations for CCDS 9838.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 75053444 75053659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 75063470 75063553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (300 nt):
ATGGCAGAAGGAAACACCCTGATATCAGTGGATTATGAAATTTTTGGGAAGGTGCAAGGGGTGTTTTTCC
GT
AAGCATACTCAGGCTGAGGGTAAAAAGCTGGGATTGGTAGGCTGGGTCCAGAACACTGACCGGGGCAC
A
GTGCAAGGACAATTGCAAGGTCCCATCTCCAAGGTGCGTCATATGCAGGAATGGCTTGAAACAAGAGGA
AGT
CCTAAATCACACATCGACAAAGCAAACTTCAACAATGAAAAAGTCATCTTGAAGTTGGATTACTCAG
AC
TTCCAAATTGTAAAATAA


Translation (99 aa):
MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRG
S
PKSHIDKANFNNEKVILKLDYSDFQIVK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser