NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS9815.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9815.2 Public Homo sapiens 14 HEATR4 24 110 108 CCDS HistoryNCBI Gene:399671Re-query CCDS DB by CCDS ID:9815.2Re-query CCDS DB by GeneID:399671See the combined annotation on chromosome 14 in Sequence Viewer

Public Note for CCDS 9815.2
The coding region has been updated to extend the N-terminus to one that is more supported by the available transcript and conservation data.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 9815.2

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000334988.2 ENSP00000335447.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000334988.2Link to Ensembl Protein Viewer:ENSP00000335447.2Re-query CCDS DB by Nucleotide ID:ENST00000334988Re-query CCDS DB by Protein ID:ENSP00000335447
Original member Current member EBI ENST00000553558.6 ENSP00000450444.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000553558.6Link to Ensembl Protein Viewer:ENSP00000450444.2Re-query CCDS DB by Nucleotide ID:ENST00000553558Re-query CCDS DB by Protein ID:ENSP00000450444
Original member Current member NCBI NM_001220484.1 NP_001207413.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001220484.1Link to Protein Sequence:NP_001207413.1Re-query CCDS DB by Nucleotide ID:NM_001220484Re-query CCDS DB by Protein ID:NP_001207413Link to BLAST:NP_001207413.1
Original member Current member NCBI NM_203309.2 NP_976054.2 Accepted alive Link to Nucleotide Sequence:NM_203309.2Link to Protein Sequence:NP_976054.2Re-query CCDS DB by Nucleotide ID:NM_203309Re-query CCDS DB by Protein ID:NP_976054Link to BLAST:NP_976054.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001207413.1 1026 Q86WZ0 1026 100% 0 0
NP_976054.2 1026 Q86WZ0 1026 100% 0 0

Chromosomal Locations for CCDS 9815.2

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 73478606 73478842 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73493066 73493124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73495228 73495387 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73496601 73496679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73498155 73498344 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73499071 73499140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73500550 73500730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73502895 73503013 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73506467 73506571 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73508134 73508294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73509312 73509473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73512006 73512149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73514031 73514234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73519023 73519163 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73520852 73521039 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 73522272 73523152 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3081 nt):
ATGACCAGGACCCAGAAGGGAAAGACCTTTCTCCCCCATTGCTTCTATCAGTCACTGCCCCCACGACTGG
GA
TGGGGCATGATTTTAAACTACTCAAAATTGAAAGGCAAGGAGGAGTGTGCCTCTGTCTCCAGTGTGCC
T
ATGGTCTTCTTCAGCTCACAGTACCGTCTACACCGCAAGAGCCAATATTTGAAAATGGCTGCTGCAAAC
CTT
ACCTTCTCTCAGGAGGTGGTGTGGCAGCGAGGCCTGCCCAGCATTCCTTATAGCCAGTACAGCTTTG
AC
CACCTCTACAATACCAATGACATCATCCATACTCCCCAGATCAGGAAGGCCCGGCCTCAGAAACCTGT
T
AGCTTCAAGTTCCTGGGTTCCTCAAGTCCCTTAACAGGAGACACCTCCCTGGCTGTGAAGACAGAAAGC
TCT
GCCAATCCCGAAAAGAAGCTGAAGAAATCAAAGCCAGCCAGCACCGTCCGGGAAGCACCCCGCCCTC
TC
ATCCATCATCCCTGCATGCATCCAGATATGCTGGGTCGGCCACCTTCTCTAGATGTGAACCTGGAGGA
A
AGAGAAGCCTGGCTTCTGCCTCCTGAGAAGGAGGCCAGAGCGTGGGAGGCCACTGTGCTGGAAAAGCTG
AAC
GAGCGCACAGCCCGATGGATCCAGAGCAAGCGTCCTCGAAGGCCTGGGGCATCCCCCAACAAGTGGC
AG
AGCTTCCTGCGCCAGCAGTACGACTGGAGTCACATTCGGGATGAGCTTACCTCTGCCAGTGACCTGGA
G
CTCCTGAAACAGCTGGAGGCAGAAGAGACAGCAGAGTTTGAGGATCAAAGTGTCATCCTGCCCCCACAG
GAA
AAGAAGAAGCCAGAACTGCTGCTTCCCGTTTACTACAGATTGCCCAGTTACTTCCAACAAGCAGAGA
CA
GTTGAGATCATGCCTGGCAACAAGAGCACTGAGGATATCCATGAAAAGACGAGCCTCTCCCAGCCCCA
A
ACCCAGAGCTACTTTCGCCAGGTGACTCCCCGAGCTGGAAAGTTTGCCTACTCCACAGACAACACCTTT
GAA
CAGGAGATTTACTTTGATGAAGTCCAGATCATCCACCAGATTGGTGCAAAGAGAGACCAGATTGTCC
TG
GAAAACCTAAATCGGTACAACAAGCAGCTATCTAAGGTCTTCCCTGAAACTCCAGAAAAGTGGAGTGC
C
CAGGCAATTCCTGAAGCATCTTACAGACCTGTGCAAGGAGCCCTGCGCTGGACTGCTTTGCCCACCCCC
GCC
AAGGATATGCTGCTGCAGGTGGGTGAGAAGGATGTGCCTATTAAGACCAGGAGATTGAAGAAGCAGG
CA
AAATCACTGCAGGAGGATGTGACCTGGGAACTGGTGGTCCTGCGGAGGATGCTGAAGGAATGGAAGAC
T
GCCTGGGCTCTGATCATAGAGTGGCACCATGAGACAGTAGAGAACCTGCTTCAGAGCTTGGGAGACCTG
CAT
GATGACGTTCGGATCAAAGCTATCACCACATGTGCCACAGCTGCTTTGGAACGGCCCCGGATTGCCA
CC
AGCCAGAGAGACTCAGACAAGACCATCCAGGACTTGCCGGAGGTTCTACTGCCTGCCCTAGAGGCTGC
T
CTTTGTGACAAGAATGCCCATGTGCGGATGGCAGCAGCAATATGCCAATATGCCATACAGTCACATAAT
CCC
CTTGCCCGGAACATCATGCAGACTGCCCTTCTGAAGGGTAACAGTGTGGATAGCTGGGCTGCAGCTC
AG
TGCTTGGCTCTGGAAGGTACTGCTACTTACCCTGTGATTAAGAGGATCCTCCACCAGCTGTTTACAAA
G
AAGAATGAGGACACTGAGGAACAGTCTTATATCCTCCTGAGCTATCTGAGTGAGAAGACAACCCTGATA
CAC
ACCATGCTTGCTGTGGAGCTGAACAGCTGTCAATGGAAGAACCGGATTGTGGCCTGCCAGGCTTTCT
CC
CGGATCAGTGGAAATGTCTGCTTGGATATGAAACATAAGTTGATCCAGCTGATGTGGAATGACTGGAA
T
AAGGAAGTGAGGAGAGCAGCTGCACAGGCGCTTGGGCAAATGAGCCTCGGGAAAGAGGTGCACGACATA
ATC
AGGGTCAAGCTAGGTCAAGGAAATTCCCAGGAGCGTGTGGAAGCTCTCTACCTGATAGGTGAGCTCA
AG
CTTATGACCGCCAAGCTTCTCCCAAGCTTCCTGCACTGCTTCTCTGATGACTTCACAGCAGTTCGGCG
G
GCAGCCTGTTTGGCAGCTGGTGCCCTGCAGATCCGCGACAAGATGGTGCTTGAATGCCTCCTGAACCTG
ATG
CAGAGAGATCCTTACTGGAAAATCAAGGCCTTTGCCATTCGAGCTTTGGGACAGATTGGGCAAGTAA
GT
CCCGAGCTGACGGATCTTCTGCTCTGGGCTATCCACTATGAAGAGTCACCAGGTGTACGGCTGGAAGC
T
TGCCGTAGCATCCTAGCCCTGAAACTTCAAGGGGACCGGGTCAGGGACACCTTCCTAGACGTGCTGCTC
CTG
GAGAACCACGATGCTGTTCTAAAAGAAATGTACCAGACAATGAAGATACTCAACTTAGGAAATGAAG
GA
AACCAAGAAATGCTTCAGGAGATCAAGAACAGGATTAAAACACTAAGCCAAAAGGACTTGCTGACACA
C
AAAATACTCAAGCTGGAGATGGTCATGGGAAAAGTGAGGGAGGAAGCAAAACGTGTTTACTTGAAACCC
AAA
GGAGAACAAGGACCACTAACACTCCAGACTTTACTCCAAGAAACTTTTCAGGATGAGATGGTTCTTC
CT
AGAAGACCTTCCGAGGTTTGTGACACTGAAGCAGTGATAAAGCCTGTGAAGCCCCGCGCACCAAATCC
C
TGGTTACAAAGTTCAGTCCCAGGCCTAACCACACGAAGCAAAGTTCGTTCATCACTTGTCAAAGATCTA
CGC
ACCTCCCCCGAGAAAAGGATTGCTGTGGGACCATTTAGATCCGACTACCCAGCTCTTTATCTGGGTA
AA
TTCTCAGAGAGAACATTTTTTTCTCCCATCATGTCTTCTCCCTCTGGAAAGAAAGGTGCTCATCTCTA
A


Translation (1026 aa):
MTRTQKGKTFLPHCFYQSLPPRLGWGMILNYSKLKGKEECASVSSVPMVFFSSQYRLHRKSQYLKMAAAN
L
TFSQEVVWQRGLPSIPYSQYSFDHLYNTNDIIHTPQIRKARPQKPVSFKFLGSSSPLTGDTSLAVKTES
S
ANPEKKLKKSKPASTVREAPRPLIHHPCMHPDMLGRPPSLDVNLEEREAWLLPPEKEARAWEATVLEKL
N
ERTARWIQSKRPRRPGASPNKWQSFLRQQYDWSHIRDELTSASDLELLKQLEAEETAEFEDQSVILPPQ
E
KKKPELLLPVYY
RLPSYFQQAETVEIMPGNKSTEDIHEKTSLSQPQTQSYFRQVTPRAGKFAYSTDNTF
E
QEIYF
DEVQIIHQIGAKRDQIVLENLNRYNKQLSKVFPETPEKWSAQAIPEASYRPVQGALRWTALPTP
A
KDMLLQVGEKDVPIKTRRLKKQAKSLQEDVTWELVVLRRMLKEWKTAWAL
IIEWHHETVENLLQSLGDL
H
DDVRIKAITTCATAALERPRIATSQRDS
DKTIQDLPEVLLPALEAALCDKNAHVRMAAAICQYAIQSHN
P
LARNIMQTALLK
GNSVDSWAAAQCLALEGTATYPVIKRILHQLFTKKNEDTEEQSYILLSYLSEKTTLI
H
TMLAVELNSCQWKNRIVACQAFSRISGNVCL
DMKHKLIQLMWNDWNKEVRRAAAQALGQMSLGKEVHDI
I
RVKLGQGNSQERVEALYLIGELKLMTAKLLPSFLHCFSDDFTAVRRAACLAAGALQIRDKMVLECLLNL
M
QRDPYWKIKAFAIR
ALGQIGQVSPELTDLLLWAIHYEESPGVRLEACRSILALKLQGDRVRDTFLDVLL
L
ENHDAVL
KEMYQTMKILNLGNEGNQEMLQEIKNRIKTLSQKDLLTHKILKLEMVMGKVREEAKRVYLKP
K
GEQGPLTLQTLLQETFQ
DEMVLPRRPSEVCDTEAVIKPVKPRAPNPWLQSSVPGLTTRSKVRSSLVKDL
R
TSPEKRIAVGPFRSDYPALYLGKFSERTFFSPIMSSPSGKKGAHL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser