NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9774.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9774.1 Public Homo sapiens 14 MAX 22 109 92 CCDS HistoryNCBI Gene:4149Re-query CCDS DB by CCDS ID:9774.1Re-query CCDS DB by GeneID:4149See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9774.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000246163.2 ENSP00000246163.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000246163.2Link to Ensembl Protein Viewer:ENSP00000246163.2Re-query CCDS DB by Nucleotide ID:ENST00000246163Re-query CCDS DB by Protein ID:ENSP00000246163
Original member Current member NCBI NM_145114.2 NP_660089.1 Accepted alive Link to Nucleotide Sequence:NM_145114.2Link to Protein Sequence:NP_660089.1Re-query CCDS DB by Nucleotide ID:NM_145114Re-query CCDS DB by Protein ID:NP_660089Link to BLAST:NP_660089.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_660089.1 96 P61244-5 96 100% 0 0

Chromosomal Locations for CCDS 9774.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 65084180 65084299 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65093708 65093815 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65101546 65101572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65102304 65102339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (291 nt):
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACA
AA
CGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCG
G
GACTCAGTCCCATCACTCCAAGGAGAGAAGCTCTATTTCCTCTTTTGGAAATTGTGTACTCCTGTCCTT
CAT
CGTCAAAGTTTGATGCAGAAATGCCACACCTTCATTTCAAGCTACCAAGTGCACAAGAAAAAAGAAT
GC
AAGATTTAA


Translation (96 aa):
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKLYFLFWKLCTPVL
H
RQSLMQKCHTFISSYQVHKKKECKI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser