NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS9757.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9757.1 Public Homo sapiens 14 RHOJ 24 110 108 CCDS HistoryNCBI Gene:57381Re-query CCDS DB by CCDS ID:9757.1Re-query CCDS DB by GeneID:57381See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9757.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000316754.8 ENSP00000316729.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000316754.8Link to Ensembl Protein Viewer:ENSP00000316729.3Re-query CCDS DB by Nucleotide ID:ENST00000316754Re-query CCDS DB by Protein ID:ENSP00000316729
Original member Current member NCBI NM_020663.5 NP_065714.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_020663.5Link to Protein Sequence:NP_065714.1Re-query CCDS DB by Nucleotide ID:NM_020663Re-query CCDS DB by Protein ID:NP_065714Link to BLAST:NP_065714.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065714.1 214 Q9H4E5-1 214 100% 0 0

Chromosomal Locations for CCDS 9757.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 63204870 63205047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 63269110 63269168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 63280971 63281135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 63283121 63283216 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 63290878 63291024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (645 nt):
ATGAACTGCAAAGAGGGAACTGACAGCAGCTGCGGCTGCAGGGGCAACGACGAGAAGAAGATGTTGAAGT
GT
GTGGTGGTGGGGGACGGTGCCGTGGGGAAAACCTGCCTGCTGATGAGCTACGCCAACGACGCCTTCCC
A
GAGGAATACGTGCCCACTGTGTTTGACCACTATGCAGTTACTGTGACTGTGGGAGGCAAGCAACACTTG
CTC
GGACTGTATGACACCGCGGGACAGGAGGACTACAACCAGCTGAGGCCACTCTCCTACCCCAACACGG
AT
GTGTTTTTGATCTGCTTCTCTGTCGTAAACCCTGCCTCTTACCACAATGTCCAGGAGGAATGGGTCCC
C
GAGCTCAAGGACTGCATGCCTCACGTGCCTTATGTCCTCATAGGGACCCAGATTGATCTCCGTGATGAC
CCA
AAAACCTTGGCCCGTTTGCTGTATATGAAAGAGAAACCTCTCACTTACGAGCATGGTGTGAAGCTCG
CA
AAAGCGATCGGAGCACAGTGCTACTTGGAATGTTCAGCTCTGACTCAGAAAGGTCTCAAAGCGGTTTT
T
GATGAAGCAATCCTCACCATTTTCCACCCCAAGAAAAAGAAGAAACGCTGTTCTGAGGGTCACAGCTGC
TGT
TCAATTATCTGA


Translation (214 aa):
MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHL
L
GLYDTAGQ
EDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDD
P
KTLARLLYMKEKPLTYEHGVKLAKA
IGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSC
C
SII




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser