NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS9576.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9576.1 Public Homo sapiens 14 MRPL52 22 109 92 CCDS HistoryNCBI Gene:122704Re-query CCDS DB by CCDS ID:9576.1Re-query CCDS DB by GeneID:122704See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9576.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000397505.2 ENSP00000380642.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397505.2Link to Ensembl Protein Viewer:ENSP00000380642.2Re-query CCDS DB by Nucleotide ID:ENST00000397505Re-query CCDS DB by Protein ID:ENSP00000380642
Original member NCBI NM_181307.2 NP_851824.1 Updated not alive Link to Nucleotide Sequence:NM_181307.2Link to Protein Sequence:NP_851824.1Re-query CCDS DB by Nucleotide ID:NM_181307Re-query CCDS DB by Protein ID:NP_851824
Current member NCBI NM_181307.3 NP_851824.1 Accepted alive Link to Nucleotide Sequence:NM_181307.3Link to Protein Sequence:NP_851824.1Re-query CCDS DB by Nucleotide ID:NM_181307Re-query CCDS DB by Protein ID:NP_851824Link to BLAST:NP_851824.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_851824.1 87 Q86TS9-4 87 100% 0 0

Chromosomal Locations for CCDS 9576.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 22829913 22829940 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 22830050 22830110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 22830187 22830254 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 22834172 22834278 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (264 nt):
ATGGCTGCTTTAGGGACTGTTCTCTTCACAGGTGTCCGGAGGCTGCACTGCAGCGTAGCCGCTTGGGCGG
GC
GGCCAGTGGCGACTACAGCAGGGACTGGCTGCCAACCCCTCCGGCTACGGGCCCCTTACCGAGCTCCC
A
GACTGGTCATATGCGGAGACGAGTTGTACTGCTGTCACAGGAAATGGACGCTGGATTACAAGCATGGCA
GCT
CAGGCAGCAGAAGTTGCAGGAAGAACAAAGGAAGCAGGAAAATGCTCTTAA


Translation (87 aa):
MAALGTVLFTGVRRLHCSVAAWAGGQWRLQQGLAANPSGYGPLTELPDWSYAETSCTAVTGNGRWITSMA
A
QAAEVAGRTKEAGKCS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser