NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9445.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9445.1 Public Homo sapiens 13 KLHL1 22 109 92 CCDS HistoryNCBI Gene:57626Re-query CCDS DB by CCDS ID:9445.1Re-query CCDS DB by GeneID:57626See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9445.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000377844.8 ENSP00000367075.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000377844.8Link to Ensembl Protein Viewer:ENSP00000367075.4Re-query CCDS DB by Nucleotide ID:ENST00000377844Re-query CCDS DB by Protein ID:ENSP00000367075
Original member Current member NCBI NM_020866.2 NP_065917.1 Accepted alive Link to Nucleotide Sequence:NM_020866.2Link to Protein Sequence:NP_065917.1Re-query CCDS DB by Nucleotide ID:NM_020866Re-query CCDS DB by Protein ID:NP_065917Link to BLAST:NP_065917.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065917.1 748 Q9NR64 748 100% 0 0

Chromosomal Locations for CCDS 9445.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 69701702 69701761 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 69707625 69707796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 69719369 69719581 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 69740394 69740556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 69796738 69796962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 69838976 69839162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 69882283 69882495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 69940040 69940236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 69961308 69961444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 69975620 69975802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 70107203 70107699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2247 nt):
ATGTCAGGCTCTGGGCGAAAAGACTTCGATGTGAAGCACATTCTGCGACTCCGCTGGAAACTCTTCAGCC
AC
CCGTCTCCTTCCACCGGCGGCCCGGCGGGGGGAGGCTGCCTGCAACAGGACGGCAGTGGCAGCTTTGA
G
CACTGGGGACCCAGCCAGAGTCGCCTGCTCAAAAGCCAAGAGAGAAGCGGTGTGAGCACTTTCTGGAAG
AAG
CCTTCCTCCTCTTCCTCTTCATCGTCCTCCCCGTCCTCTTCCTCCTCTTCCTTCAATCCGCTGAATG
GC
ACCCTGCTTCCAGTTGCCACGAGGCTGCAGCAAGGGGCTCCTGGGCAGGGCACTCAGCAGCCAGCCAG
G
ACTCTCTTCTACGTGGAGTCACTAGAGGAGGAGGTGGTGCCAGGCATGGACTTTCCTGGACCACACGAA
AAA
GGGCTGGTTCTGCAAGAGCTCAAAGTGGAGCCAGACAACTCTAGCCAGGCAACAGGTGAAGGATGTG
GA
CACAGGCTGTCATCAACCGGCCATTCAATGACACCTCAAAGTGATTTGGACTCCAGTAGCTCTGAAGA
A
TTCTATCAAGCTGTTCATCATGCTGAGCAAACCTTCAGAAAGATGGAAAGTTATTTGAAGCAGCAGCAA
CTT
TGTGATGTTATCCTGATTGTTGGGAACCGAAAGATACCTGCACATAGGCTTGTTCTGAGTTCAGTCT
CC
GACTATTTTGCGGCCATGTTTACAAGTGATGTTTGTGAAGCCAAGCAAGAGGAGATCAAAATGGAAGG
C
ATAGACCCCAATGCTCTCTGGGACCTTGTCCAATTTGCATATACAGGCTGCTTGGAATTAAAAGAGGAC
ACC
ATTGAGAACCTTCTTGCTGCAGCGTGCCTTCTTCAGCTTCCACAGGTGGTGGAAGTGTGCTGCCACT
TC
CTCATGAAGCTTTTGCATCCATCTAACTGTTTAGGAATTCGAGCCTTCGCAGATGCTCAAGGATGCAT
T
GAGTTAATGAAGGTGGCCCACAGCTACACAATGGAAAACATAATGGAAGTTATCAGAAATCAAGAGTTT
TTA
CTCCTTCCAGCTGAGGAGCTCCATAAACTACTGGCCAGTGATGATGTCAATGTTCCTGATGAAGAAA
CC
ATCTTCCATGCATTGATGATGTGGGTCAAGTATGACATGCAGAGTAGATGCAATGACCTGAGCATGCT
T
CTTGCCTTTATAAGACTGCCACTGCTTCCACCACAGATATTGGCTGACCTAGAAAATCATGCATTATTT
AAG
AATGATCTGGAATGTCAAAAGCTGATTCTAGAAGCAATGAAATACCATCTATTGCCAGAAAGAAGAA
CT
TTAATGCAAAGTCCGAGAACTAAACCCAGAAAATCTACAGTCGGAACTTTGTATGCTGTAGGAGGAAT
G
GATAACAACAAAGGAGCTACAACTATAGAGAAATATGATCTGAGAACAAATCTGTGGATCCAGGCAGGG
ATG
ATGAATGGCAGAAGGCTGCAGTTTGGTGTGGCTGTTATTGATGACAAACTCTTTGTAATTGGAGGTC
GA
GATGGCTTAAAGACATTGAACACTGTTGAATGTTACAATCCCAAAACCAAGACATGGACTGTCTTACC
A
CCAATGTCAACACACAGACATGGTCTAGGTGTAACAGTACTTGAAGGCCCTATTTATGCTGTGGGAGGC
CAT
GATGGCTGGAGCTATCTGAATACAGTGGAAAGGTGGGATCCACAGAGTCAACAATGGACATTTGTAG
CC
AGTATGTCAATTGCTCGGAGCACAGTTGGTGTAGCAGCATTGAATGGCAAGTTGTATTCAGTTGGAGG
T
CGTGATGGAAGTTCCTGTTTGAGTTCAATGGAATATTATGATCCTCATACAAATAAGTGGAACATGTGT
GCT
CCCATGTGTAAGAGGAGAGGGGGTGTCGGAGTGGCCACATGTGACGGTTTTCTTTATGCAGTAGGAG
GT
CATGATGCTCCTGCTTCAAATCACTGTTCCCGGCTACTGGATTATGTAGAAAGATATGATCCCAAAAC
A
GACACTTGGACCATGGTGGCTCCTTTGAGTATGCCCAGAGATGCTGTTGGGGTCTGTCTCCTTGGTGAC
AGA
TTATATGCTGTTGGTGGCTATGATGGACAGACATACCTCAACACTATGGAATCCTATGACCCACAAA
CT
AATGAGTGGACACAGATGGCTTCCTTGAATATTGGGAGAGCAGGTGCCTGTGTGGTAGTCATCAAGCA
A
CCTTGA


Translation (748 aa):
MSGSGRKDFDVKHILRLRWKLFSHPSPSTGGPAGGGCLQQDGSGSFEHWGPSQSRLLKSQERSGVSTFWK
K
PSSSSSSSSSPSSSSSSFNPLNGTLLPVATRLQQGAPGQGTQQPARTLFYVESLEEEVVPGMDFPGPHE
K
GLVLQELKVEPDNSSQATGEGCGH
RLSSTGHSMTPQSDLDSSSSEEFYQAVHHAEQTFRKMESYLKQQQ
L
CDVILIVGNRKIPAH
RLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFAYTGCLELKED
T
IENLLAAACLLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTM
ENIMEVIRNQEF
L
LLPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQSRCNDLSMLLAFIRLPLLPPQ
ILADLENHALF
K
NDLECQKLILEAMKYHLLPERRTLMQSPRTKPRKSTVGTLYAVGGMDNNK
GATTIEKYDLRTNLWIQAG
M
MNGRRLQFGVAVIDDKLFVIGGRDGLKTLNTVECYNPKTKTWTVLPPMSTHRHGL
GVTVLEGPIYAVGG
H
DGWSYLNTVERWDPQSQQWTFVASMSIARSTVGVAALNG
KLYSVGGRDGSSCLSSMEYYDPHTNKWNMC
A
PMCKRRGGVGVATCDGFLYAVGGHDAPASNHCSRLLDYVE
RYDPKTDTWTMVAPLSMPRDAVGVCLLGD
R
LYAVGGYDGQTYLNTMESYDPQTNEWTQ
MASLNIGRAGACVVVIKQP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser