NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS94.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
94.1 Public Homo sapiens 1 ERRFI1 22 109 92 CCDS HistoryNCBI Gene:54206Re-query CCDS DB by CCDS ID:94.1Re-query CCDS DB by GeneID:54206See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 94.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000377482.9 ENSP00000366702.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000377482.9Link to Ensembl Protein Viewer:ENSP00000366702.5Re-query CCDS DB by Nucleotide ID:ENST00000377482Re-query CCDS DB by Protein ID:ENSP00000366702
Original member NCBI NM_018948.3 NP_061821.1 Updated not alive Link to Nucleotide Sequence:NM_018948.3Link to Protein Sequence:NP_061821.1Re-query CCDS DB by Nucleotide ID:NM_018948Re-query CCDS DB by Protein ID:NP_061821
Current member NCBI NM_018948.4 NP_061821.1 Accepted alive Link to Nucleotide Sequence:NM_018948.4Link to Protein Sequence:NP_061821.1Re-query CCDS DB by Nucleotide ID:NM_018948Re-query CCDS DB by Protein ID:NP_061821Link to BLAST:NP_061821.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_061821.1 462 Q9UJM3 462 100% 0 0

Chromosomal Locations for CCDS 94.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 8013210 8014396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 8015308 8015384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 8015495 8015619 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1389 nt):
ATGTCAATAGCAGGAGTTGCTGCTCAGGAGATCAGAGTCCCATTAAAAACTGGATTTCTACATAATGGCC
GA
GCCATGGGGAATATGAGGAAGACCTACTGGAGCAGTCGCAGTGAGTTTAAAAACAACTTTTTAAATAT
T
GACCCGATAACCATGGCCTACAGTCTGAACTCTTCTGCTCAGGAGCGCCTAATACCACTTGGGCATGCT
TCC
AAATCTGCTCCGATGAATGGCCACTGCTTTGCAGAAAATGGTCCATCTCAAAAGTCCAGCTTGCCCC
CT
CTTCTTATTCCCCCAAGTGAAAACTTGGGACCACATGAAGAGGATCAAGTTGTATGTGGTTTTAAGAA
A
CTCACAGTGAATGGGGTTTGTGCTTCCACCCCTCCACTGACACCCATAAAAAACTCCCCTTCCCTTTTC
CCC
TGTGCCCCTCTTTGTGAACGGGGTTCTAGGCCTCTTCCACCGTTGCCAATCTCTGAAGCCCTCTCTC
TG
GATGACACAGACTGTGAGGTGGAATTCCTAACTAGCTCAGATACAGACTTCCTTTTAGAAGACTCTAC
A
CTTTCTGATTTCAAATATGATGTTCCTGGCAGGCGAAGCTTCCGTGGGTGTGGACAAATCAACTATGCA
TAT
TTTGATACCCCAGCTGTTTCTGCAGCAGATCTCAGCTATGTGTCTGACCAAAATGGAGGTGTCCCAG
AT
CCAAATCCTCCTCCACCTCAGACCCACCGAAGATTAAGAAGGTCTCATTCGGGACCAGCTGGCTCCTT
T
AACAAGCCAGCCATAAGGATATCCAACTGTTGTATACACAGAGCTTCTCCTAACTCCGATGAAGACAAA
CCT
GAGGTTCCCCCCAGAGTTCCCATACCTCCTAGACCAGTAAAGCCAGATTATAGAAGATGGTCAGCAG
AA
GTTACTTCGAGCACCTATAGTGATGAAGACAGGCCTCCCAAAGTACCGCCAAGAGAACCTTTGTCACC
G
AGTAACTCGCGCACACCGAGTCCCAAAAGCCTTCCGTCTTACCTCAATGGGGTCATGCCCCCGACACAG
AGC
TTTGCCCCTGATCCCAAGTATGTCAGCAGCAAAGCACTGCAAAGACAGAACAGCGAAGGATCTGCCA
GT
AAGGTTCCTTGCATTCTGCCCATTATTGAAAATGGGAAGAAGGTTAGTTCAACACATTATTACCTACT
A
CCTGAACGACCACCATACCTGGACAAATATGAAAAATTTTTTAGGGAAGCAGAAGAAACAAATGGAGGC
GCC
CAAATCCAGCCATTACCTGCTGACTGCGGTATATCTTCAGCCACAGAAAAGCCAGACTCAAAAACAA
AA
ATGGATCTGGGTGGCCACGTGAAGCGTAAACATTTATCCTATGTGGTTTCTCCTTAG


Translation (462 aa):
MSIAGVAAQEIRVPLKTGFLHNGRAMGNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSAQERLIPLGHA
S
KSAPMNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTVNGVCASTPPLTPIKNSPSLF
P
CAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTDFLLEDSTLSDFKYDVPGRRSFRGCGQINYA
Y
FDTPAVSAADLSYVSDQNGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDK
P
EVPPRVPIPPRPVKPDYRRWSAEVTSSTYSDEDRPPKVPPREPLSPSNSRTPSPKSLPSYLNGVMPPTQ
S
FAPDPKYVSSKALQRQNSEGSASKVPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKFFREAEETNGG
A
QIQPLPADCGISSATEKPDSKTKMDLGGHVKRKHLSYVVSP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser