NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS9396.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9396.1 Public Homo sapiens 13 KCTD4 22 109 92 CCDS HistoryNCBI Gene:386618Re-query CCDS DB by CCDS ID:9396.1Re-query CCDS DB by GeneID:386618See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9396.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000379108.1 ENSP00000368402.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379108.1Link to Ensembl Protein Viewer:ENSP00000368402.1Re-query CCDS DB by Nucleotide ID:ENST00000379108Re-query CCDS DB by Protein ID:ENSP00000368402
Original member NCBI NM_198404.2 NP_940686.2 Updated not alive Link to Nucleotide Sequence:NM_198404.2Link to Protein Sequence:NP_940686.2Re-query CCDS DB by Nucleotide ID:NM_198404Re-query CCDS DB by Protein ID:NP_940686
Current member NCBI NM_198404.3 NP_940686.2 Accepted alive Link to Nucleotide Sequence:NM_198404.3Link to Protein Sequence:NP_940686.2Re-query CCDS DB by Nucleotide ID:NM_198404Re-query CCDS DB by Protein ID:NP_940686Link to BLAST:NP_940686.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_940686.2 259 Q8WVF5 259 100% 0 0

Chromosomal Locations for CCDS 9396.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 45193788 45194567 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (780 nt):
ATGGAGCGTAAAATAAACAGAAGAGAAAAAGAAAAGGAGTATGAAGGGAAACACAACAGCCTGGAAGATA
CT
GATCAAGGAAAGAACTGCAAATCCACACTGATGACCCTCAACGTTGGTGGATATTTATACATTACTCA
A
AAACAAACACTGACCAAGTACCCAGACACTTTCCTTGAAGGTATAGTAAATGGAAAAATCCTCTGCCCG
TTT
GATGCTGATGGTCATTATTTCATAGACAGGGATGGTCTCCTCTTCAGGCATGTCCTAAACTTCCTAC
GA
AATGGAGAACTTCTATTGCCCGAAGGGTTTCGAGAAAATCAACTTCTTGCACAAGAAGCAGAATTCTT
T
CAGCTCAAGGGACTGGCAGAGGAAGTGAAATCCAGGTGGGAGAAAGAACAGCTAACACCCAGAGAGACT
ACT
TTCTTGGAAATAACAGATAACCACGATCGTTCACAAGGATTAAGAATCTTCTGTAATGCTCCTGATT
TC
ATATCAAAAATAAAGTCTCGCATTGTTCTGGTGTCCAAAAGCAGGCTGGATGGATTTCCAGAGGAGTT
T
TCAATATCGTCAAATATCATCCAATTTAAATACTTCATAAAGTCTGAAAATGGCACTCGACTTGTACTA
AAG
GAAGACAACACCTTTGTCTGTACCTTGGAAACTCTTAAGTTTGAGGCTATCATGATGGCTTTAAAGT
GT
GGCTTTAGACTGCTGACCAGCCTGGATTGTTCCAAAGGGTCAATTGTTCACAGCGATGCACTTCATTT
T
ATCAAGTAA


Translation (259 aa):
MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCP
F
DADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRET
T
FLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFIKSENGTRLVL
K
EDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser