NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS9368.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9368.2 Public Homo sapiens 13 PROSER1 24 110 108 CCDS HistoryNCBI Gene:80209Re-query CCDS DB by CCDS ID:9368.2Re-query CCDS DB by GeneID:80209See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 9368.2

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000352251.8 ENSP00000332034.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000352251.8Link to Ensembl Protein Viewer:ENSP00000332034.4Re-query CCDS DB by Nucleotide ID:ENST00000352251Re-query CCDS DB by Protein ID:ENSP00000332034
Original member Current member NCBI NM_025138.5 NP_079414.3 MANE Select Accepted alive Link to Nucleotide Sequence:NM_025138.5Link to Protein Sequence:NP_079414.3Re-query CCDS DB by Nucleotide ID:NM_025138Re-query CCDS DB by Protein ID:NP_079414Link to BLAST:NP_079414.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079414.3 944 Q86XN7-1 944 100% 0 0

Chromosomal Locations for CCDS 9368.2

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 39011365 39011487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39012083 39012233 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39012691 39014476 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39017500 39017544 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39022326 39022412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39023052 39023130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39024473 39024556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39026277 39026387 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39028227 39028320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39029281 39029375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39031563 39031631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39034131 39034196 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 39037198 39037242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2835 nt):
ATGGATAAAAAGTCCTTTGAAATGGTGCTGGATGAAATTAGAAAGGCTGTTTTGACAGAATACAAATTAA
AA
GCAATTGAATATGTGCATGGATACTTTTCTAGTGAACAGGTGGTTGATTTGCTGAGATATTTTTCCTG
G
GCCGAGCCCCAGTTGAAGGCAATGAAAGCATTACAGCATAAAATGGTGGCTGTCCAGCCAACAGAAGTG
GTC
AATATACTCAACTGTTTCACTTTCAGTAAAGACAAACTAGTTGCTCTTGAACTGTTAGCCTCGAACA
TT
ATTGATGCACAGAATTCTCGTCCTATTGAAGATTTATTCAGGGTAAATATGTCTGAGAAGAAACGGTG
C
AAGAGAATACTTGAACAGGCTTTCAAGGGGGGCTGCAAAGCTCCTCATGCTATGATATCTTCTTGTGGA
ACA
ATCCCAGGAAATCCATATCCCAAAGGAAGACCTAGCCGCATAAATGGAATTTTCCCAGGAACTCCTT
TG
AAAAAAGATGGTGAAGAATGTACTAACGAAGGCAAAGGAATAGCTGCACGAATTCTTGGGCCATCCAA
A
CCACCTCCTTCAACATATAATCCACATAAACCTGTTCCTTATCCGATACCTCCATGCCGACCACATGCA
ACT
ATTGCACCAAGTGCTTATAACAATGCAGGTCTGGTACCATTAGCGAATGTCATAGCTCCACCTCCAC
CT
CCATATACTCCTAATCCTGTAGGAACAGAGAATGAAGACCTTTCGAATCCGTCAAAACCTATACAGAA
T
CAAACATTTTCCACCCCAGCAAGTCAACTCTTTTCTCCTCATGGTTCTAATCCTTCAACACCTGCTGCA
ACT
CCTGTTCCTACTGCATCCCCAGTCAAGGCAATTAATCATCCATCAGCATCAGCAGCTGCCACCGTTT
CT
GGAATGAACCTGCTGAATACTGTCCTTCCTGTGTTCCCAGGGCAGGTCTCCTCAGCCGTTCACACACC
T
CAGCCATCAATACCAAACCCAACAGTTATCAGAACCCCTTCATTGCCCACTGCACCTGTTACATCCATC
CAC
AGTACAACCACCACTCCTGTTCCTTCCATTTTTTCTGGCCTAGTGTCACTGCCAGGTCCTTCTGCCA
CT
CCTACCGCAGCCACTCCTACCCCAGGACCTACACCACGGTCCACTCTTGGTTCCAGTGAAGCATTTGC
T
TCTACTTCTGCACCTTTCACTAGCCTCCCCTTTTCCACCAGCTCTTCTGCTGCTTCTACCAGCAACCCA
AAT
TCTGCTTCATTGTCATCAGTTTTTGCAGGGCTCCCTTTGCCCTTACCACCAACATCCCAAGGCCTAT
CC
AACCCGACTCCTGTAATTGCTGGTGGCTCTACTCCCAGCGTTGCCGGTCCACTTGGTGTGAACAGTCC
T
CTTTTGTCTGCGTTAAAAGGTTTTCTGACATCCAATGACACCAATTTAATCAACTCCTCTGCTTTATCC
TCT
GCTGTCACAAGTGGGCTGGCTTCACTATCTTCTCTTACTCTTCAGAACTCTGACTCTTCTGCTTCAG
CC
CCTAACAAGTGCTATGCCCCATCAGCCATCCCTACCCCACAGAGGACTTCCACTCCAGGGTTGGCCCT
G
TTCCCAGGCCTGCCGTCTCCCGTGGCTAACTCAACTTCCACTCCCCTGACATTGCCTGTACAGTCTCCT
TTA
GCCACTGCTGCATCAGCTTCCACGTCAGTGCCAGTTAGCTGTGGCTCCTCAGCCTCCCTTTTGCGTG
GC
CCCCACCCAGGTACCTCAGATCTGCATATTTCATCTACCCCTGCTGCAACAACTCTTCCTGTTATGAT
C
AAAACTGAGCCCACAAGTCCTACTCCCTCGGCCTTCAAAGGTCCATCTCATTCTGGGAATCCCTCTCAT
GGC
ACTTTAGGTTTGTCAGGGACATTGGGCCGTGCATATACTTCAACATCCGTGCCCATCAGTTTATCTG
CT
TGCCTTAATCCTGCATTGTCAGGTCTCTCCAGCTTGAGTACTCCTTTAAATGGTTCAAATCCTCTTTC
C
TCTATTTCCCTTCCACCACATGGTTCCTCCACTCCCATTGCACCAGTATTCACTGCTCTTCCTTCTTTT
ACT
TCTTTGACCAACAATTTTCCTTTAACTGGCAACCCATCTCTTAATCCGTCAGTATCTCTCCCAGGGT
CA
TTAATAGCCACCTCATCTACCGCTGCCACCTCCACATCTCTCCCTCATCCTAGCTCAACGGCAGCTGT
T
CTCTCAGGGCTTTCTGCTTCAGCACCAGTCTCAGCAGCACCTTTCCCCCTCAACCTGTCCACTGCTGTT
CCC
TCACTTTTCTCTGTTACTCAAGGACCTCTGTCATCTTCAAATCCCTCCTATCCAGGCTTTTCTGTCT
CT
AATACCCCAAGCGTTACCCCTGCTCTTCCCTCATTCCCGGGGCTGCAGGCGCCCTCTACAGTCGCAGC
T
GTCACACCACTACCTGTGGCTGCCACAGCCCCATCCCCAGCTCCAGTCCTCCCAGGATTCGCCTCAGCA
TTC
AGTTCCAATTTCAACTCCGCTCTTGTTGCACAAGCCGGTTTATCATCTGGACTTCAAGCTGCAGGCA
GT
TCTGTTTTTCCAGGCCTTTTGTCCCTCCCGGGTATCCCTGGGTTTCCTCAGAATCCTTCACAATCATC
C
TTGCAAGAATTACAGCATAATGCGGCTGCGCAGTCAGCATTGTTACAGCAGGTCCATTCAGCTTCGGCT
CTG
GAAAGCTATCCAGCTCAGCCTGATGGGTTTCCTAGTTATCCTTCAGCGCCAGGAACACCATTTTCTT
TG
CAACCAAGCCTGTCCCAGAGTGGGTGGCAGTGA


Translation (944 aa):
MDKKSFEMVLDEIRKAVLTEYKLKAIEYVHGYFSSEQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEV
V
NILNCFTFSKDKLVALELLA
SNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAMISSCG
T
IPGNPYPKGRPSRINGIFP
GTPLKKDGEECTNEGKGIAARILGPSKPPPSTYNPHKPVPYPIPPCRPHA
T
IAP
SAYNNAGLVPLANVIAPPPPPYTPNPVGTENEDLSNPSKPIQNQTFSTPASQLFSPHGSNPSTPAA
T
PVPTASPVKAINHPSASAAATVSGMNLLNTVLPVFPGQVSSAVHTPQPSIPNPTVIRTPSLPTAPVTSI
H
STTTTPVPSIFSGLVSLPGPSATPTAATPTPGPTPRSTLGSSEAFASTSAPFTSLPFSTSSSAASTSNP
N
SASLSSVFAGLPLPLPPTSQGLSNPTPVIAGGSTPSVAGPLGVNSPLLSALKGFLTSNDTNLINSSALS
S
AVTSGLASLSSLTLQNSDSSASAPNKCYAPSAIPTPQRTSTPGLALFPGLPSPVANSTSTPLTLPVQSP
L
ATAASASTSVPVSCGSSASLLRGPHPGTSDLHISSTPAATTLPVMIKTEPTSPTPSAFKGPSHSGNPSH
G
TLGLSGTLGRAYTSTSVPISLSACLNPALSGLSSLSTPLNGSNPLSSISLPPHGSSTPIAPVFTALPSF
T
SLTNNFPLTGNPSLNPSVSLPGSLIATSSTAATSTSLPHPSSTAAVLSGLSASAPVSAAPFPLNLSTAV
P
SLFSVTQGPLSSSNPSYPGFSVSNTPSVTPALPSFPGLQAPSTVAAVTPLPVAATAPSPAPVLPGFASA
F
SSNFNSALVAQA
GLSSGLQAAGSSVFPGLLSLPGIPGFPQNPSQSSLQELQHNAAAQSALLQQVHSASA
L
ESYPAQPDGFPSYPSAPGTPFSLQPSLSQSGWQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser