NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, April 25, 2024, starting at 7:00 a.m. EDT for up to 120 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS9361.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9361.1 Public Homo sapiens 13 ALG5 24 110 108 CCDS HistoryNCBI Gene:29880Re-query CCDS DB by CCDS ID:9361.1Re-query CCDS DB by GeneID:29880See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9361.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000239891.4 ENSP00000239891.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000239891.4Link to Ensembl Protein Viewer:ENSP00000239891.3Re-query CCDS DB by Nucleotide ID:ENST00000239891Re-query CCDS DB by Protein ID:ENSP00000239891
Original member Current member NCBI NM_013338.5 NP_037470.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_013338.5Link to Protein Sequence:NP_037470.1Re-query CCDS DB by Nucleotide ID:NM_013338Re-query CCDS DB by Protein ID:NP_037470Link to BLAST:NP_037470.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_037470.1 324 Q9Y673-1 324 100% 0 0

Chromosomal Locations for CCDS 9361.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 36949942 36950057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 36952514 36952599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 36965575 36965726 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 36971977 36972036 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 36985627 36985740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 36989484 36989576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 36993604 36993672 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 36994989 36995035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 36995425 36995596 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 36999235 36999300 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (975 nt):
ATGGCTCCGCTTCTGTTGCAGCTGGCGGTGCTCGGCGCGGCGCTGGCGGCCGCAGCCCTCGTACTGATTT
CC
ATCGTTGCATTTACAACTGCTACAAAAATGCCAGCACTCCATCGACATGAAGAAGAGAAATTCTTCTT
A
AATGCCAAAGGCCAGAAAGAAACTTTACCCAGCATATGGGACTCACCTACCAAACAACTTTCTGTCGTT
GTG
CCTTCATACAATGAAGAAAAACGGTTGCCTGTGATGATGGATGAAGCTCTGAGCTATCTAGAGAAGA
GA
CAGAAACGAGATCCTGCGTTCACTTATGAAGTGATAGTAGTTGATGATGGCAGTAAAGATCAGACCTC
A
AAGGTAGCTTTTAAATATTGCCAGAAATATGGAAGTGACAAAGTACGTGTGATAACCCTGGTGAAGAAT
CGT
GGAAAAGGTGGAGCGATTAGAATGGGTATATTCAGTTCTCGAGGAGAAAAGATCCTTATGGCAGATG
CT
GATGGAGCCACAAAGTTTCCAGATGTTGAGAAATTAGAAAAGGGGCTAAATGATCTACAGCCTTGGCC
T
AATCAAATGGCTATAGCATGTGGATCTCGAGCTCATTTAGAAAAAGAATCAATTGCTCAGCGTTCTTAC
TTC
CGTACTCTTCTCATGTATGGGTTCCACTTTCTGGTGTGGTTCCTTTGTGTCAAAGGAATCAGGGACA
CA
CAGTGTGGGTTCAAATTATTTACTCGAGAAGCAGCTTCACGGACGTTTTCATCTCTACACGTTGAACG
A
TGGGCATTTGATGTAGAACTACTGTACATAGCACAGTTCTTTAAAATTCCAATAGCAGAAATTGCTGTC
AAC
TGGACAGAAATTGAAGGTTCTAAATTAGTTCCATTCTGGAGCTGGCTACAAATGGGTAAAGACCTAC
TT
TTTATACGACTTCGATATTTGACTGGTGCCTGGAGGCTTGAGCAAACTCGGAAAATGAATTAG


Translation (324 aa):
MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVV
V
PSYNEEKR
LPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKN
R
GKGGAIRM
GIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSY
F
RTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVER
WAFDVELLYIAQFFKIPIAEIAV
N
WTEIE
GSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser