NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, April 25, 2024, starting at 7:00 a.m. EDT for up to 120 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS9333.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9333.1 Public Homo sapiens 13 SLC7A1 24 110 108 CCDS HistoryNCBI Gene:6541Re-query CCDS DB by CCDS ID:9333.1Re-query CCDS DB by GeneID:6541See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9333.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000380752.10 ENSP00000370128.5 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000380752.10Link to Ensembl Protein Viewer:ENSP00000370128.5Re-query CCDS DB by Nucleotide ID:ENST00000380752Re-query CCDS DB by Protein ID:ENSP00000370128
Original member Current member NCBI NM_003045.5 NP_003036.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_003045.5Link to Protein Sequence:NP_003036.1Re-query CCDS DB by Nucleotide ID:NM_003045Re-query CCDS DB by Protein ID:NP_003036Link to BLAST:NP_003036.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003036.1 629 P30825 629 100% 0 0

Chromosomal Locations for CCDS 9333.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 29514480 29514583 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 29516138 29516246 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 29517144 29517310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 29517573 29517790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 29519447 29519549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 29522317 29522456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 29523266 29523488 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 29524132 29524253 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 29530538 29530712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 29532824 29532982 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 29535819 29536188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1890 nt):
ATGGGGTGCAAAGTCCTGCTCAACATTGGGCAGCAGATGCTGCGGCGGAAGGTGGTGGACTGTAGCCGGG
AG
GAGACGCGGCTGTCTCGCTGCCTGAACACTTTTGATCTGGTGGCCCTCGGGGTGGGCAGCACACTGGG
T
GCTGGTGTCTACGTCCTGGCTGGAGCTGTGGCCCGTGAGAATGCAGGCCCTGCCATTGTCATCTCCTTC
CTG
ATCGCTGCGCTGGCCTCAGTGCTGGCTGGCCTGTGCTATGGCGAGTTTGGTGCTCGGGTCCCCAAGA
CG
GGCTCAGCTTACCTCTACAGCTATGTCACCGTTGGAGAGCTCTGGGCCTTCATCACCGGCTGGAACTT
A
ATCCTCTCCTACATCATCGGTACTTCAAGCGTAGCGAGGGCCTGGAGCGCCACCTTCGACGAGCTGATA
GGC
AGACCCATCGGGGAGTTCTCACGGACACACATGACTCTGAACGCCCCCGGCGTGCTGGCTGAAAACC
CC
GACATATTCGCAGTGATCATAATTCTCATCTTGACAGGACTTTTAACTCTTGGTGTGAAAGAGTCGGC
C
ATGGTCAACAAAATATTCACTTGTATTAACGTCCTGGTCCTGGGCTTCATAATGGTGTCAGGATTTGTG
AAA
GGATCGGTTAAAAACTGGCAGCTCACGGAGGAGGATTTTGGGAACACATCAGGCCGTCTCTGTTTGA
AC
AATGACACAAAAGAAGGGAAGCCCGGTGTTGGTGGATTCATGCCCTTCGGGTTCTCTGGTGTCCTGTC
G
GGGGCAGCGACTTGCTTCTATGCCTTCGTGGGCTTTGACTGCATCGCCACCACAGGTGAAGAGGTGAAG
AAC
CCACAGAAGGCCATCCCCGTGGGGATCGTGGCGTCCCTCTTGATCTGCTTCATCGCCTACTTTGGGG
TG
TCGGCTGCCCTCACGCTCATGATGCCCTACTTCTGCCTGGACAATAACAGCCCCCTGCCCGACGCCTT
T
AAGCACGTGGGCTGGGAAGGTGCCAAGTACGCAGTGGCCGTGGGCTCCCTCTGCGCTCTTTCCGCCAGT
CTT
CTAGGTTCCATGTTTCCCATGCCTCGGGTTATCTATGCCATGGCTGAGGATGGACTGCTATTTAAAT
TC
TTAGCCAACGTCAATGATAGGACCAAAACACCAATAATCGCCACATTAGCCTCGGGTGCCGTTGCTGC
T
GTGATGGCCTTCCTCTTTGACCTGAAGGACTTGGTGGACCTCATGTCCATTGGCACTCTCCTGGCTTAC
TCG
TTGGTGGCTGCCTGTGTGTTGGTCTTACGGTACCAGCCAGAGCAGCCTAACCTGGTATACCAGATGG
CC
AGTACTTCCGACGAGTTAGATCCAGCAGACCAAAATGAATTGGCAAGCACCAATGATTCCCAGCTGGG
C
TTTTTACCAGAGGCAGAGATGTTCTCTTTGAAAACCATACTCTCACCCAAAAACATGGAGCCTTCCAAA
ATC
TCTGGGCTAATTGTGAACATTTCAACCAGCCTCATAGCTGTTCTCATCATCACCTTCTGCATTGTGA
CC
GTGCTTGGAAGGGAGGCTCTCACCAAAGGGGCGCTGTGGGCAGTCTTTCTGCTCGCAGGGTCTGCCCT
C
CTCTGTGCCGTGGTCACGGGCGTCATCTGGAGGCAGCCCGAGAGCAAGACCAAGCTCTCATTTAAGGTT
CCC
TTCCTGCCAGTGCTCCCCATCCTGAGCATCTTCGTGAACGTCTATCTCATGATGCAGCTGGACCAGG
GC
ACCTGGGTCCGGTTTGCTGTGTGGATGCTGATAGGCTTCATCATCTACTTTGGCTATGGCCTGTGGCA
C
AGCGAGGAGGCGTCCCTGGATGCCGACCAAGCAAGGACTCCTGACGGCAACTTGGACCAGTGCAAGTGA


Translation (629 aa):
MGCKVLLNIGQQMLRRKVVDCSREETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISF
L
IAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYII
GTSSVARAWSATFDELI
G
RPIGEFSRTHMTLNAPGVLAENPDIFAVIIILILT
GLLTLGVKESAMVNKIFTCINVLVLGFIMVSGFV
K
GSVKNWQLTEEDFGNTSGRLCLN
NDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVK
N
PQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSA
S
L
LGSMFPMPRVIYAMAEDGLLFKFLANVNDRTKTPIIATLASGAVA
AVMAFLFDLKDLVDLMSIGTLLAY
S
LVAACVLVL
RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSK
I
SGLIVNISTSLI
AVLIITFCIVTVLGREALTKGALWAVFLLAGSALLCAVVTGVIWRQPESKTKLSFKV
P
FLPVLPILSIFVNVYLMMQLDQGTWVRFAVWMLI
GFIIYFGYGLWHSEEASLDADQARTPDGNLDQCK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser