NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS9188.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9188.1 Public Homo sapiens 12 TAOK3 24 110 108 CCDS HistoryNCBI Gene:51347Re-query CCDS DB by CCDS ID:9188.1Re-query CCDS DB by GeneID:51347See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9188.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000392533.8 ENSP00000376317.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000392533.8Link to Ensembl Protein Viewer:ENSP00000376317.3Re-query CCDS DB by Nucleotide ID:ENST00000392533Re-query CCDS DB by Protein ID:ENSP00000376317
Original member Current member EBI ENST00000419821.6 ENSP00000416374.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000419821.6Link to Ensembl Protein Viewer:ENSP00000416374.2Re-query CCDS DB by Nucleotide ID:ENST00000419821Re-query CCDS DB by Protein ID:ENSP00000416374
Original member Current member NCBI NM_001346488.2 NP_001333417.1 Accepted alive Link to Nucleotide Sequence:NM_001346488.2Link to Protein Sequence:NP_001333417.1Re-query CCDS DB by Nucleotide ID:NM_001346488Re-query CCDS DB by Protein ID:NP_001333417Link to BLAST:NP_001333417.1
Original member Current member NCBI NM_001346489.2 NP_001333418.1 Accepted alive Link to Nucleotide Sequence:NM_001346489.2Link to Protein Sequence:NP_001333418.1Re-query CCDS DB by Nucleotide ID:NM_001346489Re-query CCDS DB by Protein ID:NP_001333418Link to BLAST:NP_001333418.1
Original member Current member NCBI NM_016281.4 NP_057365.3 MANE Select Accepted alive Link to Nucleotide Sequence:NM_016281.4Link to Protein Sequence:NP_057365.3Re-query CCDS DB by Nucleotide ID:NM_016281Re-query CCDS DB by Protein ID:NP_057365Link to BLAST:NP_057365.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001333417.1 898 Q9H2K8 898 100% 0 0
NP_001333418.1 898 Q9H2K8 898 100% 0 0
NP_057365.3 898 Q9H2K8 898 100% 0 0

Chromosomal Locations for CCDS 9188.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 118150997 118151158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118152227 118152409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118160146 118160358 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118161788 118162027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118172457 118172660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118177201 118177329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118181371 118181607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118189807 118189941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118199051 118199257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118201296 118201463 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118212914 118212995 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118214017 118214110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118233674 118233765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118235558 118235671 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118238073 118238169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118239227 118239272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118243415 118243516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118244894 118244965 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 118255448 118255567 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2697 nt):
ATGCGTAAAGGGGTGCTGAAGGACCCAGAGATTGCCGATCTATTCTACAAAGATGATCCTGAGGAACTTT
TT
ATTGGTTTGCATGAAATTGGACATGGAAGTTTTGGAGCAGTTTATTTTGCTACAAATGCTCACACCAG
T
GAGGTGGTGGCAATTAAGAAGATGTCCTATAGTGGGAAGCAGACCCATGAGAAATGGCAAGATATTCTT
AAG
GAAGTTAAATTTTTACGACAATTGAAGCATCCTAATACTATTGAGTACAAAGGCTGTTACTTGAAAG
AA
CACACTGCTTGGTTGGTGATGGAATATTGCTTAGGCTCAGCCTCTGATTTATTAGAAGTTCATAAAAA
A
CCACTTCAGGAAGTGGAGATCGCTGCCATTACTCATGGAGCCTTGCATGGACTAGCCTACCTACATTCT
CAT
GCATTGATTCATAGGGATATTAAAGCAGGAAATATTCTTCTAACAGAGCCAGGTCAGGTAAAACTAG
CT
GATTTTGGATCTGCTTCAATGGCTTCTCCTGCCAACTCCTTCGTGGGCACACCTTACTGGATGGCTCC
A
GAGGTGATCTTAGCTATGGATGAAGGACAGTATGATGGGAAAGTTGATATTTGGTCACTTGGCATCACT
TGT
ATTGAATTGGCGGAACGGAAGCCGCCCCTTTTCAACATGAATGCAATGAGTGCCTTATATCACATTG
CC
CAGAATGACTCCCCAACGTTACAGTCTAATGAATGGACAGACTCCTTTAGGAGATTTGTTGATTACTG
C
TTGCAGAAAATACCTCAGGAAAGGCCAACATCAGCAGAACTATTAAGGCATGACTTTGTTCGACGAGAC
CGG
CCACTACGTGTCCTCATTGACCTCATACAGAGGACAAAAGATGCAGTTCGTGAGCTAGATAACCTAC
AG
TACCGAAAAATGAAAAAAATACTTTTCCAAGAGACACGGAATGGACCCTTGAATGAGTCACAGGAGGA
T
GAGGAAGACAGTGAACATGGAACCAGCCTGAACAGGGAAATGGACAGCCTGGGCAGCAACCATTCCATT
CCA
AGCATGTCCGTGAGCACAGGCAGCCAGAGCAGCAGTGTGAACAGCATGCAGGAAGTCATGGACGAGA
GC
AGTTCCGAACTTGTCATGATGCACGATGACGAAAGCACAATCAATTCCAGCTCCTCCGTCGTGCATAA
G
AAAGATCATGTATTCATAAGGGATGAGGCGGGCCACGGCGATCCCAGGCCTGAGCCGCGGCCTACCCAG
TCA
GTTCAGAGCCAGGCCCTCCACTACCGGAACAGAGAGCGCTTTGCCACGATCAAATCAGCATCTTTGG
TT
ACACGACAGATCCATGAGCATGAGCAGGAGAACGAGTTGCGGGAACAGATGTCAGGTTATAAGCGGAT
G
CGGCGCCAGCACCAGAAGCAGCTGATCGCCCTGGAGAACAAGCTGAAGGCTGAGATGGACGAGCACCGC
CTC
AAGCTACAGAAGGAGGTGGAGACGCATGCCAACAACTCGTCCATCGAGCTGGAGAAGCTGGCCAAGA
AG
CAAGTGGCTATCATAGAAAAGGAGGCAAAGGTAGCTGCAGCAGATGAGAAGAAGTTCCAGCAACAGAT
C
TTGGCCCAGCAGAAGAAAGATTTGACAACTTTCTTAGAAAGTCAGAAGAAGCAGTATAAGATTTGTAAG
GAA
AAAATAAAAGAGGAAATGAATGAGGACCATAGCACACCCAAGAAAGAGAAGCAAGAGCGGATCTCCA
AA
CATAAAGAGAACTTGCAGCACACACAGGCTGAAGAGGAAGCCCACCTTCTCACTCAACAGAGACTGTA
C
TACGACAAAAATTGTCGTTTCTTCAAGCGGAAAATAATGATCAAGCGGCACGAGGTGGAGCAGCAGAAC
ATT
CGGGAGGAACTAAATAAAAAGAGGACCCAGAAGGAGATGGAGCATGCCATGCTAATCCGGCACGACG
AG
TCCACCCGAGAGCTAGAGTACAGGCAGCTGCACACGTTACAGAAGCTACGCATGGATCTGATCCGTTT
A
CAGCACCAGACGGAACTGGAAAACCAGCTGGAGTACAATAAGAGGCGAGAAAGAGAACTGCACAGAAAG
CAT
GTCATGGAACTTCGGCAACAGCCAAAAAACTTAAAGGCCATGGAAATGCAAATTAAAAAACAGTTTC
AG
GACACTTGCAAAGTACAGACCAAACAGTATAAAGCACTCAAGAATCACCAGTTGGAAGTTACTCCAAA
G
AATGAGCACAAAACAATCTTAAAGACACTGAAAGATGAGCAGACAAGAAAACTTGCCATTTTGGCAGAG
CAG
TATGAACAGAGTATAAATGAAATGATGGCCTCTCAAGCGTTACGGCTAGATGAGGCTCAAGAAGCAG
AA
TGCCAGGCCTTGAGGCTACAGCTCCAGCAGGAAATGGAGCTGCTCAACGCCTACCAGAGCAAAATCAA
G
ATGCAAACAGAGGCACAACATGAACGTGAGCTCCAGAAGCTAGAGCAGAGAGTGTCTCTGCGCAGAGCA
CAC
CTTGAGCAGAAGATTGAAGAGGAGCTGGCTGCCCTTCAGAAGGAACGCAGCGAGAGAATAAAGAACC
TA
TTGGAAAGGCAAGAGCGAGAGATTGAAACTTTTGACATGGAGAGCCTCAGAATGGGATTTGGGAATTT
G
GTTACATTAGATTTTCCTAAGGAGGACTACAGATGA


Translation (898 aa):
MRKGVLKDPEIADLFYKDDPEELFIGLHEIGHGSFGAVYFATNAHTSEVVAIKKMSYSGKQTHEKWQDIL
K
EVKFLRQLKHPNTIEYKGCYLKEHTAW
LVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALHGLAYLHS
H
ALIH
RDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGIT
C
IEL
AERKPPLFNMNAMSALYHIAQNDSPTLQSNEWTDSFRRFVDYCLQKIPQERPTSAELLRHDFVRRD
R
PLRVLIDLIQRTKDAVRELDNLQYRKMKKILFQETRNGPLNESQEDEE
DSEHGTSLNREMDSLGSNHSI
P
SMSVSTGSQSSSVNSMQEVMDESSSELVMMHDDESTINSSSSVVHKK
DHVFIRDEAGHGDPRPEPRPTQ
S
VQSQALHYRNRERFATIKSASL
VTRQIHEHEQENELREQMSGYKRMRRQHQKQLIALENKLKAEMDEHR
L
KLQKEVETHANNSSIELEKLAKKQVAIIEKE
AKVAAADEKKFQQQILAQQKKDLTTFLESQKKQYKICK
E
KIKE
EMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHLLTQQRLYYDKNCRFFKRKIMIKRHEVEQQN
I
RE
ELNKKRTQKEMEHAMLIRHDESTRELEYRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRK
H
VMELRQQPKNLK
AMEMQIKKQFQDTCKVQTKQYKALKNHQLEVTPKNEHKTILKTLKDEQTRKLAILAE
Q
YEQSINEMMASQA
LRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRA
H
LEQK
IEEELAALQKERSERIKNLLERQEREIETFDMESLRMGFGNLVTLDFPKEDYR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser