NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS9086.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9086.1 Public Homo sapiens 12 CHPT1 24 110 108 CCDS HistoryNCBI Gene:56994Re-query CCDS DB by CCDS ID:9086.1Re-query CCDS DB by GeneID:56994See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9086.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000229266.8 ENSP00000229266.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000229266.8Link to Ensembl Protein Viewer:ENSP00000229266.3Re-query CCDS DB by Nucleotide ID:ENST00000229266Re-query CCDS DB by Protein ID:ENSP00000229266
Original member Current member NCBI NM_020244.3 NP_064629.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_020244.3Link to Protein Sequence:NP_064629.2Re-query CCDS DB by Nucleotide ID:NM_020244Re-query CCDS DB by Protein ID:NP_064629Link to BLAST:NP_064629.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_064629.2 406 Q8WUD6-1 406 100% 0 0

Chromosomal Locations for CCDS 9086.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 101697862 101698134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101714090 101714237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101714504 101714645 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101716728 101716812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101720123 101720254 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101723168 101723326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101723722 101723847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101726294 101726404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 101728901 101728945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1221 nt):
ATGGCGGCAGGCGCCGGGGCCGGGTCCGCGCCGCGCTGGCTGAGGGCGCTGAGCGAGCCGCTGAGCGCGG
CG
CAGCTGCGGCGACTGGAGGAGCACCGCTACAGCGCGGCGGGCGTCTCGCTGCTCGAGCCGCCGCTGCA
G
CTCTACTGGACCTGGCTGCTCCAGTGGATCCCGCTCTGGATGGCCCCCAACTCCATCACCCTGCTGGGG
CTC
GCCGTCAACGTGGTCACCACGCTCGTGCTCATCTCCTACTGTCCCACGGCCACCGAAGAGGCACCAT
AC
TGGACATACCTTTTATGTGCACTGGGACTTTTTATTTACCAGTCACTGGATGCTATTGATGGGAAACA
A
GCCAGAAGAACAAACTCTTGTTCCCCTTTAGGGGAGCTCTTTGACCATGGCTGTGACTCTCTTTCCACA
G
TA
TTTATGGCAGTGGGAGCTTCAATTGCCGCTCGCTTAGGAACTTATCCTGACTGGTTTTTTTTCTGCT
CT
TTTATTGGGATGTTTGTGTTTTATTGCGCTCATTGGCAGACTTATGTTTCAGGCATGTTGAGATTTGG
A
AAAGTGGATGTAACTGAAATTCAGATAGCTTTAGTGATTGTCTTTGTGTTGTCTGCATTTGGAGGAGCA
ACA
ATGTGGGACTATACGATTCCTATTCTAGAAATAAAATTGAAGATCCTTCCAGTTCTTGGATTTCTAG
GT
GGAGTAATATTTTCCTGTTCAAATTATTTCCATGTTATCCTCCATGGTGGTGTTGGCAAGAATGGATC
C
ACTATAGCAGGCACCAGTGTCTTGTCACCTGGACTCCACATAGGACTAATTATTATACTGGCAATAATG
ATC
TATAAAAAGTCAGCAACTGATGTGTTTGAAAAGCATCCTTGTCTTTATATCCTAATGTTTGGATGTG
TC
TTTGCTAAAGTCTCACAAAAATTAGTGGTAGCTCACATGACCAAAAGTGAACTATATCTTCAAGACAC
T
GTCTTTTTGGGGCCAGGTCTTTTGTTTTTAGACCAGTACTTTAATAACTTTATAGACGAATATGTTGTT
CTA
TGGATGGCAATGGTGATTTCTTCATTTGATATGGTGATATACTTTAGTGCTTTGTGCCTGCAAATTT
CA
AGACACCTTCATCTAAATATATTCAAGACTGCATGTCATCAAGCACCTGAACAGGTTCAAGTTCTTTC
T
TCAAAGAGTCATCAGAATAACATGGATTGA


Translation (406 aa):
MAAGAGAGSAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLWMAPNSITLLG
L
AVNVVTTLVLISYCPTATEE
APYWTYLLCALGLFIYQSLDAIDGKQARRTNSCSPLGELFDHGCDSLST
V
FMAVGASIAARLGTYPDWFFFCSFIGMFVFYCAHWQTYVSGMLRFGKVDVTEIQIALVIVFVLSAFGGA
T
MWDYT
IPILEIKLKILPVLGFLGGVIFSCSNYFHVILHGGVGKNGSTIAGTSVLSPGLHIGLIIILAIM
I
YKKSATDVFEKHPCLYILMFGCVFAKVSQKLV
VAHMTKSELYLQDTVFLGPGLLFLDQYFNNFIDEYVV
L
WMAM
VISSFDMVIYFSALCLQISRHLHLNIFKTACHQAPEQVQVLSSKSHQNNMD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser