NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8970.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8970.1 Public Homo sapiens 12 GNS 22 109 92 CCDS HistoryNCBI Gene:2799Re-query CCDS DB by CCDS ID:8970.1Re-query CCDS DB by GeneID:2799See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8970.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000258145.7 ENSP00000258145.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000258145.7Link to Ensembl Protein Viewer:ENSP00000258145.3Re-query CCDS DB by Nucleotide ID:ENST00000258145Re-query CCDS DB by Protein ID:ENSP00000258145
Original member NCBI NM_002076.3 NP_002067.1 Updated not alive Link to Nucleotide Sequence:NM_002076.3Link to Protein Sequence:NP_002067.1Re-query CCDS DB by Nucleotide ID:NM_002076Re-query CCDS DB by Protein ID:NP_002067
Current member NCBI NM_002076.4 NP_002067.1 Accepted alive Link to Nucleotide Sequence:NM_002076.4Link to Protein Sequence:NP_002067.1Re-query CCDS DB by Nucleotide ID:NM_002076Re-query CCDS DB by Protein ID:NP_002067Link to BLAST:NP_002067.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002067.1 552 P15586-1 552 100% 0 0

Chromosomal Locations for CCDS 8970.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 64716741 64716819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64720022 64720182 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64721595 64721705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64723006 64723113 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64728956 64729057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64737004 64737107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64739381 64739499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64740606 64740688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64743141 64743308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64744809 64744907 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64745659 64745724 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64747712 64747918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64752698 64752757 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 64759085 64759276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1659 nt):
ATGCGGCTCCTGCCTCTAGCCCCAGGTCGGCTCCGGCGGGGCAGCCCCCGCCACCTGCCCTCCTGCAGCC
CA
GCGCTGCTACTGCTGGTGCTGGGCGGCTGCCTGGGGGTCTTCGGGGTGGCTGCGGGAACCCGGAGGCC
C
AACGTGGTGCTGCTCCTCACGGACGACCAGGACGAAGTGCTCGGCGGCATGACACCGCTAAAGAAAACC
AAA
GCTCTCATCGGAGAGATGGGGATGACTTTTTCCAGTGCTTATGTGCCAAGTGCTCTCTGCTGCCCCA
GC
AGAGCCAGTATCCTGACAGGAAAGTACCCACATAATCATCACGTTGTGAACAACACTCTGGAGGGGAA
C
TGCAGTAGTAAGTCCTGGCAGAAGATCCAAGAACCAAATACTTTCCCAGCAATTCTCAGATCAATGTGT
GGT
TATCAGACCTTTTTTGCAGGGAAATATTTAAATGAGTACGGAGCCCCAGATGCAGGTGGACTAGAAC
AC
GTTCCTCTGGGTTGGAGTTACTGGTATGCCTTGGAAAAGAATTCTAAGTATTATAATTACACCCTGTC
T
ATCAATGGGAAGGCACGGAAGCATGGTGAAAACTATAGTGTGGACTACCTGACAGATGTTTTGGCTAAT
GTC
TCCTTGGACTTTCTGGACTACAAGTCCAACTTTGAGCCCTTCTTCATGATGATCGCCACTCCAGCGC
CT
CATTCGCCTTGGACAGCTGCACCTCAGTACCAGAAGGCTTTCCAGAATGTCTTTGCACCAAGAAACAA
G
AACTTCAACATCCATGGAACGAACAAGCACTGGTTAATTAGGCAAGCCAAGACTCCAATGACTAATTCT
TCA
ATACAGTTTTTAGATAATGCATTTAGGAAAAGGTGGCAAACTCTCCTCTCAGTTGATGACCTTGTGG
AG
AAACTGGTCAAGAGGCTGGAGTTCACTGGGGAGCTCAACAACACTTACATCTTCTATACCTCAGACAA
T
GGCTATCACACAGGACAGTTTTCCTTGCCAATAGACAAGAGACAGCTGTATGAGTTTGATATCAAAGTT
CCA
CTGTTGGTTCGAGGACCTGGGATCAAACCAAATCAGACAAGCAAGATGCTGGTTGCCAACATTGACT
TG
GGTCCTACTATTTTGGACATTGCTGGCTACGACCTAAATAAGACACAGATGGATGGGATGTCCTTATT
G
CCCATTTTGAGAGGTGCCAGTAACTTGACCTGGCGATCAGATGTCCTGGTGGAATACCAAGGAGAAGGC
CGT
AACGTCACTGACCCAACATGCCCTTCCCTGAGTCCTGGCGTATCTCAATGCTTCCCAGACTGTGTAT
GT
GAAGATGCTTATAACAATACCTATGCCTGTGTGAGGACAATGTCAGCATTGTGGAATTTGCAGTATTG
C
GAGTTTGATGACCAGGAGGTGTTTGTAGAAGTCTATAATCTGACTGCAGACCCAGACCAGATCACTAAC
ATT
GCTAAAACCATAGACCCAGAGCTTTTAGGAAAGATGAACTATCGGTTAATGATGTTACAGTCCTGTT
CT
GGGCCAACCTGTCGCACTCCAGGGGTTTTTGACCCCGGATACAGGTTTGACCCCCGTCTCATGTTCAG
C
AATCGCGGCAGTGTCAGGACTCGAAGATTTTCCAAACATCTTCTGTAG


Translation (552 aa):
MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKT
K
ALIGEMGMTFSSA
YVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMC
G
YQTFFAGKYLNE
YGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLAN
V
SLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGT
NKHWLIRQAKTPMTNS
S
IQFLDNAFRK
RWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKV
P
LLVRGPGIKPNQTSK
MLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEG
R
NVTDPTCPSLSPGVS
QCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITN
I
AKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDP
GYRFDPRLMFSNRGSVRTRRFSKHLL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser