NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8961.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8961.1 Public Homo sapiens 12 SLC16A7 22 109 92 CCDS HistoryNCBI Gene:9194Re-query CCDS DB by CCDS ID:8961.1Re-query CCDS DB by GeneID:9194See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8961.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000261187.8 ENSP00000261187.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000261187.8Link to Ensembl Protein Viewer:ENSP00000261187.4Re-query CCDS DB by Nucleotide ID:ENST00000261187Re-query CCDS DB by Protein ID:ENSP00000261187
Original member Current member EBI ENST00000547379.5 ENSP00000448071.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000547379.5Link to Ensembl Protein Viewer:ENSP00000448071.1Re-query CCDS DB by Nucleotide ID:ENST00000547379Re-query CCDS DB by Protein ID:ENSP00000448071
Original member Current member EBI ENST00000552024.5 ENSP00000448742.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000552024.5Link to Ensembl Protein Viewer:ENSP00000448742.1Re-query CCDS DB by Nucleotide ID:ENST00000552024Re-query CCDS DB by Protein ID:ENSP00000448742
Original member Current member EBI ENST00000552432.5 ENSP00000449547.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000552432.5Link to Ensembl Protein Viewer:ENSP00000449547.1Re-query CCDS DB by Nucleotide ID:ENST00000552432Re-query CCDS DB by Protein ID:ENSP00000449547
Original member NCBI NM_001270622.1 NP_001257551.1 Updated not alive Link to Nucleotide Sequence:NM_001270622.1Link to Protein Sequence:NP_001257551.1Re-query CCDS DB by Nucleotide ID:NM_001270622Re-query CCDS DB by Protein ID:NP_001257551
Current member NCBI NM_001270622.2 NP_001257551.1 Accepted alive Link to Nucleotide Sequence:NM_001270622.2Link to Protein Sequence:NP_001257551.1Re-query CCDS DB by Nucleotide ID:NM_001270622Re-query CCDS DB by Protein ID:NP_001257551Link to BLAST:NP_001257551.1
Original member NCBI NM_001270623.1 NP_001257552.1 Updated not alive Link to Nucleotide Sequence:NM_001270623.1Link to Protein Sequence:NP_001257552.1Re-query CCDS DB by Nucleotide ID:NM_001270623Re-query CCDS DB by Protein ID:NP_001257552
Current member NCBI NM_001270623.2 NP_001257552.1 Accepted alive Link to Nucleotide Sequence:NM_001270623.2Link to Protein Sequence:NP_001257552.1Re-query CCDS DB by Nucleotide ID:NM_001270623Re-query CCDS DB by Protein ID:NP_001257552Link to BLAST:NP_001257552.1
Original member NCBI NM_004731.4 NP_004722.2 Updated not alive Link to Nucleotide Sequence:NM_004731.4Link to Protein Sequence:NP_004722.2Re-query CCDS DB by Nucleotide ID:NM_004731Re-query CCDS DB by Protein ID:NP_004722
Current member NCBI NM_004731.5 NP_004722.2 Accepted alive Link to Nucleotide Sequence:NM_004731.5Link to Protein Sequence:NP_004722.2Re-query CCDS DB by Nucleotide ID:NM_004731Re-query CCDS DB by Protein ID:NP_004722Link to BLAST:NP_004722.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001257551.1 478 O60669 478 100% 0 0
NP_001257552.1 478 O60669 478 100% 0 0
NP_004722.2 478 O60669 478 100% 0 0

Chromosomal Locations for CCDS 8961.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 59704802 59705018 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 59771219 59771362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 59774657 59775475 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 59779423 59779679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1437 nt):
ATGCCACCAATGCCAAGTGCCCCACCTGTGCATCCACCTCCAGATGGAGGATGGGGTTGGATTGTGGTTG
GA
GCAGCTTTTATCTCCATTGGATTTTCCTATGCATTCCCCAAAGCTGTCACCGTATTCTTCAAAGAAAT
T
CAGCAAATATTCCACACTACCTACAGTGAAATAGCATGGATTTCATCCATTATGCTGGCTGTTATGTAC
GCA
GGAGGTCCTGTAAGTAGTGTTTTGGTGAATAAATACGGCAGCCGGCCGGTGGTGATAGCAGGAGGCT
TA
TTATGCTGTCTTGGAATGGTGTTGGCCTCCTTTAGTAGCAGCGTGGTACAGCTGTACCTCACTATGGG
A
TTCATTACAGGTTTAGGTTTAGCCTTCAACCTGCAACCCGCCTTAACCATAATTGGCAAATACTTCTAT
AGG
AAGCGACCCATGGCAAATGGATTGGCCATGGCAGGAAGTCCTGTTTTCTTAAGTTCATTGGCTCCTT
TC
AATCAGTACCTTTTTAATACTTTTGGCTGGAAAGGAAGCTTCCTGATTTTGGGAAGTCTACTTTTGAA
T
GCCTGTGTGGCTGGTTCCCTCATGAGACCCCTTGGACCCAATCAAACCACTTCTAAGTCTAAAAATAAG
ACT
GGCAAAACAGAAGATGATTCAAGCCCAAAGAAAATCAAAACGAAGAAATCAACTTGGGAAAAAGTTA
AT
AAGTATTTAGATTTCTCCCTTTTTAAGCATAGAGGATTTCTGATATATCTGTCTGGAAATGTCATTAT
G
TTCCTAGGTTTTTTTGCCCCCATTATATTCTTGGCTCCATATGCTAAAGACCAAGGAATTGATGAGTAC
TCG
GCAGCTTTTCTGCTATCTGTTATGGCTTTCGTTGATATGTTTGCTAGGCCTTCTGTAGGATTAATTG
CA
AACTCCAAATATATTCGACCTCGAATTCAGTACTTCTTCAGTTTTGCAATCATGTTCAATGGAGTGTG
T
CACCTCTTGTGCCCACTGGCACAGGACTACACAAGCCTGGTATTATATGCTGTATTTTTTGGCCTTGGA
TTT
GGGAGTGTTAGCAGTGTTCTCTTTGAAACTCTCATGGACCTCGTGGGTGCACCAAGATTTTCCAGTG
CC
GTCGGACTTGTCACAATTGTGGAGTGTGGCCCAGTTCTTCTTGGCCCTCCTCTTGCAGGTAAATTGGT
G
GATTTAACTGGAGAATATAAATACATGTACATGTCCTGTGGGGCTATTGTGGTAGCAGCAAGCGTGTGG
CTG
CTCATTGGCAATGCTATCAACTATAGATTGCTTGCAAAGGAAAGGAAGGAGGAAAATGCAAGGCAGA
AG
ACCAGAGAATCTGAACCCTTGAGCAAATCTAAACATTCGGAAGATGTTAACGTCAAAGTTTCAAATGC
A
CAGAGTGTAACCTCAGAAAGAGAAACTAACATTTAA


Translation (478 aa):
MPPMPSAPPVHPPPDGGWGWIVVGAAFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAWISSIMLAVMY
A
G
GPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFITGLGLAFNLQPALTIIGKYFY
R
KRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLILGSLLLNACVAGSLMRPLGPNQTTSKSKNK
T
GKTEDDSSPKKIKTKKSTWEKVNKYLDFSLFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEY
S
AAFLLSVMAFVDMFARPSVGLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLG
F
GSVSSVLFETLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLA
GKLVDLTGEYKYMYMSCGAIVVAASVW
L
LIGNAINYRLLAKERKEENARQKTRESEPLSKSKHSEDVNVKVSNAQSVTSERETNI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser