NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8932.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8932.1 Public Homo sapiens 12 LRP1 22 109 92 CCDS HistoryNCBI Gene:4035Re-query CCDS DB by CCDS ID:8932.1Re-query CCDS DB by GeneID:4035See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8932.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000243077.7 ENSP00000243077.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000243077.7Link to Ensembl Protein Viewer:ENSP00000243077.3Re-query CCDS DB by Nucleotide ID:ENST00000243077Re-query CCDS DB by Protein ID:ENSP00000243077
Original member Current member NCBI NM_002332.2 NP_002323.2 Accepted alive Link to Nucleotide Sequence:NM_002332.2Link to Protein Sequence:NP_002323.2Re-query CCDS DB by Nucleotide ID:NM_002332Re-query CCDS DB by Protein ID:NP_002323Link to BLAST:NP_002323.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002323.2 4544 Q07954-1 4544 100% 0 0

Chromosomal Locations for CCDS 8932.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 57128965 57129031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57138459 57138581 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57141374 57141511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57143679 57143798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57144972 57145100 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57145227 57145490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57154208 57154370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57154479 57154701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57156094 57156283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57156777 57156920 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57158402 57158638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57159825 57160005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57160893 57161115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57162317 57162518 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57162858 57162983 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57165805 57165945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57166084 57166209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57166930 57167046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57167444 57167524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57169140 57169307 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57173168 57173350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57173780 57173980 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57175460 57175705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57175909 57176106 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57177041 57177245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57177427 57177591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57178359 57178603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57178890 57179021 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57179329 57179556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57179782 57179956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57180047 57180141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57180330 57180479 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57180667 57180807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57181157 57181291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57183379 57183510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57183775 57183909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57184085 57184214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57184326 57184452 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57184839 57184990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57185081 57185205 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57185531 57185908 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57187267 57187456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57190805 57191009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57191320 57191512 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57192845 57192970 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57193176 57193304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57193566 57193685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57193899 57194012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57194354 57194503 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57194577 57194699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57194985 57195101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57195271 57195399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57195658 57195780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57195863 57196003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57196087 57196277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57196982 57197165 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57197299 57197384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57197545 57197664 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57198156 57198343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57198465 57198670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57199212 57199400 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57199877 57200025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57200442 57200535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57200699 57200815 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57201034 57201153 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57201497 57201619 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57201780 57201905 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57202421 57202537 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57203181 57203287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57203389 57203521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57204410 57204529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57204627 57204749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57205109 57205249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57205351 57205485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57205558 57205677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57206473 57206741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57208038 57208216 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57208711 57208817 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57209083 57209199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57209692 57209868 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57210029 57210169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57210307 57210480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57210718 57210879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57211176 57211350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57211487 57211588 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57211750 57211814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57211927 57212017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57212117 57212261 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 57212415 57212555 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (13635 nt):
ATGCTGACCCCGCCGTTGCTCCTGCTGCTGCCCCTGCTCTCAGCTCTGGTCGCGGCGGCTATCGACGCCC
CT
AAGACTTGCAGCCCCAAGCAGTTTGCCTGCAGAGATCAAATAACCTGTATCTCAAAGGGCTGGCGGTG
C
GACGGTGAGAGGGACTGCCCAGACGGATCTGACGAGGCCCCTGAGATTTGTCCACAGAGTAAGGCCCAG
CGA
TGCCAGCCAAACGAGCATAACTGCCTGGGTACTGAGCTGTGTGTTCCCATGTCCCGCCTCTGCAATG
GG
GTCCAGGACTGCATGGACGGCTCAGATGAGGGGCCCCACTGCCGAGAGCTCCAAGGCAACTGCTCTCG
C
CTGGGCTGCCAGCACCATTGTGTCCCCACACTCGATGGGCCCACCTGCTACTGCAACAGCAGCTTTCAG
CTT
CAGGCAGATGGCAAGACCTGCAAAGATTTTGATGAGTGCTCAGTGTACGGCACCTGCAGCCAGCTAT
GC
ACCAACACAGACGGCTCCTTCATATGTGGCTGTGTTGAAGGATACCTCCTGCAGCCGGATAACCGCTC
C
TGCAAGGCCAAGAACGAGCCAGTAGACCGGCCCCCTGTGCTGTTGATAGCCAACTCCCAGAACATCTTG
GCC
ACGTACCTGAGTGGGGCCCAGGTGTCTACCATCACACCTACGAGCACGCGGCAGACCACAGCCATGG
AC
TTCAGCTATGCCAACGAGACCGTATGCTGGGTGCATGTTGGGGACAGTGCTGCTCAGACGCAGCTCAA
G
TGTGCCCGCATGCCTGGCCTAAAGGGCTTCGTGGATGAGCACACCATCAACATCTCCCTCAGTCTGCAC
C
AC
GTGGAACAGATGGCCATCGACTGGCTGACAGGCAACTTCTACTTTGTGGATGACATCGATGATAGGA
TC
TTTGTCTGCAACAGAAATGGGGACACATGTGTCACATTGCTAGACCTGGAACTCTACAACCCCAAGGG
C
ATTGCCCTGGACCCTGCCATGGGGAAGGTGTTTTTCACTGACTATGGGCAGATCCCAAAGGTGGAACGC
TGT
GACATGGATGGGCAGAACCGCACCAAGCTCGTCGACAGCAAGATTGTGTTTCCTCATGGCATCACGC
TG
GACCTGGTCAGCCGCCTTGTCTACTGGGCAGATGCCTATCTGGACTATATTGAAGTGGTGGACTATGA
G
GGCAAGGGCCGCCAGACCATCATCCAGGGCATCCTGATTGAGCACCTGTACGGCCTGACTGTGTTTGAG
AAT
TATCTCTATGCCACCAACTCGGACAATGCCAATGCCCAGCAGAAGACGAGTGTGATCCGTGTGAACC
GC
TTTAACAGCACCGAGTACCAGGTTGTCACCCGGGTGGACAAGGGTGGTGCCCTCCACATCTACCACCA
G
AGGCGTCAGCCCCGAGTGAGGAGCCATGCCTGTGAAAACGACCAGTATGGGAAGCCGGGTGGCTGCTCT
GAC
ATCTGCCTGCTGGCCAACAGCCACAAGGCGCGGACCTGCCGCTGCCGTTCCGGCTTCAGCCTGGGCA
GT
GACGGGAAGTCATGCAAGAAGCCGGAGCATGAGCTGTTCCTCGTGTATGGCAAGGGCCGGCCAGGCAT
C
ATCCGGGGCATGGATATGGGGGCCAAGGTCCCGGATGAGCACATGATCCCCATTGAAAACCTCATGAAC
CCC
CGAGCCCTGGACTTCCACGCTGAGACCGGCTTCATCTACTTTGCCGACACCACCAGCTACCTCATTG
GC
CGCCAGAAGATTGATGGCACTGAGCGGGAGACCATCCTGAAGGACGGCATCCACAATGTGGAGGGTGT
G
GCCGTGGACTGGATGGGAGACAATCTGTACTGGACGGACGATGGGCCCAAAAAGACAATCAGCGTGGCC
AGG
CTGGAGAAAGCTGCTCAGACCCGCAAGACTTTAATCGAGGGCAAAATGACACACCCCAGGGCTATTG
TG
GTGGATCCACTCAATGGGTGGATGTACTGGACAGACTGGGAGGAGGACCCCAAGGACAGTCGGCGTGG
G
CGGCTGGAGAGGGCGTGGATGGATGGCTCACACCGAGACATCTTTGTCACCTCCAAGACAGTGCTTTGG
CCC
AATGGGCTAAGCCTGGACATCCCGGCTGGGCGCCTCTACTGGGTGGATGCCTTCTACGACCGCATCG
AG
ACGATACTGCTCAATGGCACAGACCGGAAGATTGTGTATGAAGGTCCTGAGCTGAACCACGCCTTTGG
C
CTGTGTCACCATGGCAACTACCTCTTCTGGACTGAGTATCGGAGTGGCAGTGTCTACCGCTTGGAACGG
GGT
GTAGGAGGCGCACCCCCCACTGTGACCCTTCTGCGCAGTGAGCGGCCCCCCATCTTTGAGATCCGAA
TG
TATGATGCCCAGCAGCAGCAAGTTGGCACCAACAAATGCCGGGTGAACAATGGCGGCTGCAGCAGCCT
G
TGCTTGGCCACCCCTGGGAGCCGCCAGTGCGCCTGTGCTGAGGACCAGGTGTTGGACGCAGACGGCGTC
ACT
TGCTTGGCGAACCCATCCTACGTGCCTCCACCCCAGTGCCAGCCAGGCGAGTTTGCCTGTGCCAACA
GC
CGCTGCATCCAGGAGCGCTGGAAGTGTGACGGAGACAACGATTGCCTGGACAACAGTGATGAGGCCCC
A
GCCCTCTGCCATCAGCACACCTGCCCCTCGGACCGATTCAAGTGCGAGAACAACCGGTGCATCCCCAAC
CGC
TGGCTCTGCGACGGGGACAATGACTGTGGGAACAGTGAAGATGAGTCCAATGCCACTTGTTCAGCCC
GC
ACCTGCCCCCCCAACCAGTTCTCCTGTGCCAGTGGCCGCTGCATCCCCATCTCCTGGACGTGTGATCT
G
GATGACGACTGTGGGGACCGCTCTGATGAGTCTGCTTCGTGTGCCTATCCCACCTGCTTCCCCCTGACT
CAG
TTTACCTGCAACAATGGCAGATGTATCAACATCAACTGGAGATGCGACAATGACAATGACTGTGGGG
AC
AACAGTGACGAAGCCGGCTGCAGCCACTCCTGTTCTAGCACCCAGTTCAAGTGCAACAGCGGGCGTTG
C
ATCCCCGAGCACTGGACCTGCGATGGGGACAATGACTGCGGAGACTACAGTGATGAGACACACGCCAAC
TGC
ACCAACCAGGCCACGAGGCCCCCTGGTGGCTGCCACACTGATGAGTTCCAGTGCCGGCTGGATGGAC
TA
TGCATCCCCCTGCGGTGGCGCTGCGATGGGGACACTGACTGCATGGACTCCAGCGATGAGAAGAGCTG
T
GAGGGAGTGACCCACGTCTGCGATCCCAGTGTCAAGTTTGGCTGCAAGGACTCAGCTCGGTGCATCAGC
AAA
GCGTGGGTGTGTGATGGCGACAATGACTGTGAGGATAACTCGGACGAGGAGAACTGCGAGTCCCTGG
CC
TGCAGGCCACCCTCGCACCCTTGTGCCAACAACACCTCAGTCTGCCTGCCCCCTGACAAGCTGTGTGA
T
GGCAACGACGACTGTGGCGACGGCTCAGATGAGGGCGAGCTCTGCGACCAGTGCTCTCTGAATAACGGT
GGC
TGCAGCCACAACTGCTCAGTGGCACCTGGCGAAGGCATTGTGTGTTCCTGCCCTCTGGGCATGGAGC
TG
GGGCCCGACAACCACACCTGCCAGATCCAGAGCTACTGTGCCAAGCATCTCAAATGCAGCCAAAAGTG
C
GACCAGAACAAGTTCAGCGTGAAGTGCTCCTGCTACGAGGGCTGGGTCCTGGAACCTGACGGCGAGAGC
TGC
CGCAGCCTGGACCCCTTCAAGCCGTTCATCATTTTCTCCAACCGCCATGAAATCCGGCGCATCGATC
TT
CACAAAGGAGACTACAGCGTCCTGGTGCCCGGCCTGCGCAACACCATCGCCCTGGACTTCCACCTCAG
C
CAGAGCGCCCTCTACTGGACCGACGTGGTGGAGGACAAGATCTACCGCGGGAAGCTGCTGGACAACGGA
G
CC
CTGACTAGTTTCGAGGTGGTGATTCAGTATGGCCTGGCCACACCCGAGGGCCTGGCTGTAGACTGGA
TT
GCAGGCAACATCTACTGGGTGGAGAGTAACCTGGATCAGATCGAGGTGGCCAAGCTGGATGGGACCCT
C
CGGACCACCCTGCTGGCCGGTGACATTGAGCACCCAAGGGCAATCGCACTGGATCCCCGGGATGGGATC
CTG
TTTTGGACAGACTGGGATGCCAGCCTGCCCCGCATTGAGGCAGCCTCCATGAGTGGGGCTGGGCGCC
GC
ACCGTGCACCGGGAGACCGGCTCTGGGGGCTGGCCCAACGGGCTCACCGTGGACTACCTGGAGAAGCG
C
ATCCTTTGGATTGACGCCAGGTCAGATGCCATTTACTCAGCCCGTTACGACGGCTCTGGCCACATGGAG
GTG
CTTCGGGGACACGAGTTCCTGTCGCACCCGTTTGCAGTGACGCTGTACGGGGGGGAGGTCTACTGGA
CT
GACTGGCGAACAAACACACTGGCTAAGGCCAACAAGTGGACCGGCCACAATGTCACCGTGGTACAGAG
G
ACCAACACCCAGCCCTTTGACCTGCAGGTGTACCACCCCTCCCGCCAGCCCATGGCTCCCAATCCCTGT
GAG
GCCAATGGGGGCCAGGGCCCCTGCTCCCACCTGTGTCTCATCAACTACAACCGGACCGTGTCCTGCG
CC
TGCCCCCACCTCATGAAGCTCCACAAGGACAACACCACCTGCTATGAGTTTAAGAAGTTCCTGCTGTA
C
GCACGTCAGATGGAGATCCGAGGTGTGGACCTGGATGCTCCCTACTACAACTACATCATCTCCTTCACG
GTG
CCCGACATCGACAACGTCACAGTGCTAGACTACGATGCCCGCGAGCAGCGTGTGTACTGGTCTGACG
TG
CGGACACAGGCCATCAAGCGGGCCTTCATCAACGGCACAGGCGTGGAGACAGTCGTCTCTGCAGACTT
G
CCAAATGCCCACGGGCTGGCTGTGGACTGGGTCTCCCGAAACCTGTTCTGGACAAGCTATGACACCAAT
AAG
AAGCAGATCAATGTGGCCCGGCTGGATGGCTCCTTCAAGAACGCAGTGGTGCAGGGCCTGGAGCAGC
CC
CATGGCCTTGTCGTCCACCCTCTGCGTGGGAAGCTCTACTGGACCGATGGTGACAACATCAGCATGGC
C
AACATGGATGGCAGCAATCGCACCCTGCTCTTCAGTGGCCAGAAGGGCCCCGTGGGCCTGGCTATTGAC
TTC
CCTGAAAGCAAACTCTACTGGATCAGCTCCGGGAACCATACCATCAACCGCTGCAACCTGGATGGGA
GT
GGGCTGGAGGTCATCGATGCCATGCGGAGCCAGCTGGGCAAGGCCACCGCCCTGGCCATCATGGGGGA
C
AAGCTGTGGTGGGCTGATCAGGTGTCGGAAAAGATGGGCACATGCAGCAAGGCTGACGGCTCGGGCTCC
GTG
GTCCTTCGGAACAGCACCACCCTGGTGATGCACATGAAGGTCTATGACGAGAGCATCCAGCTGGACC
AT
AAGGGCACCAACCCCTGCAGTGTCAACAACGGTGACTGCTCCCAGCTCTGCCTGCCCACGTCAGAGAC
G
ACCCGCTCCTGCATGTGCACAGCCGGCTATAGCCTCCGGAGTGGCCAGCAGGCCTGCGAGGGCGTAGGT
TCC
TTTCTCCTGTACTCTGTGCATGAGGGAATCAGGGGAATTCCCCTGGATCCCAATGACAAGTCAGATG
CC
CTGGTCCCAGTGTCCGGGACCTCGCTGGCTGTCGGCATCGACTTCCACGCTGAAAATGACACCATCTA
C
TGGGTGGACATGGGCCTGAGCACGATCAGCCGGGCCAAGCGGGACCAGACGTGGCGTGAAGACGTGGTG
ACC
AATGGCATTGGCCGTGTGGAGGGCATTGCAGTGGACTGGATCGCAGGCAACATCTACTGGACAGACC
AG
GGCTTTGATGTCATCGAGGTCGCCCGGCTCAATGGCTCCTTCCGCTACGTGGTGATCTCCCAGGGTCT
A
GACAAGCCCCGGGCCATCACCGTCCACCCGGAGAAAGGGTACTTGTTCTGGACTGAGTGGGGTCAGTAT
CCG
CGTATTGAGCGGTCTCGGCTAGATGGCACGGAGCGTGTGGTGCTGGTCAACGTCAGCATCAGCTGGC
CC
AACGGCATCTCAGTGGACTACCAGGATGGGAAGCTGTACTGGTGCGATGCACGGACAGACAAGATTGA
A
CGGATCGACCTGGAGACAGGTGAGAACCGCGAGGTGGTTCTGTCCAGCAACAACATGGACATGTTTTCA
GTG
TCTGTGTTTGAGGATTTCATCTACTGGAGTGACAGGACTCATGCCAACGGCTCTATCAAGCGCGGGA
GC
AAAGACAATGCCACAGACTCCGTGCCCCTGCGAACCGGCATCGGCGTCCAGCTTAAAGACATCAAAGT
C
TTCAACCGGGACCGGCAGAAAGGCACCAACGTGTGCGCGGTGGCCAATGGCGGGTGCCAGCAGCTGTGC
CTG
TACCGGGGCCGTGGGCAGCGGGCCTGCGCCTGTGCCCACGGGATGCTGGCTGAAGACGGAGCATCGT
GC
CGCGAGTATGCCGGCTACCTGCTCTACTCAGAGCGCACCATTCTCAAGAGTATCCACCTGTCGGATGA
G
CGCAACCTCAATGCGCCCGTGCAGCCCTTCGAGGACCCTGAGCACATGAAGAACGTCATCGCCCTGGCC
TTT
GACTACCGGGCAGGCACCTCTCCGGGCACCCCCAATCGCATCTTCTTCAGCGACATCCACTTTGGGA
AC
ATCCAACAGATCAACGACGATGGCTCCAGGAGGATCACCATTGTGGAAAACGTGGGCTCCGTGGAAGG
C
CTGGCCTATCACCGTGGCTGGGACACTCTCTATTGGACAAGCTACACGACATCCACCATCACGCGCCAC
ACA
GTGGACCAGACCCGCCCAGGGGCCTTCGAGCGTGAGACCGTCATCACTATGTCTGGAGATGACCACC
CA
CGGGCCTTCGTTTTGGACGAGTGCCAGAACCTCATGTTCTGGACCAACTGGAATGAGCAGCATCCCAG
C
ATCATGCGGGCGGCGCTCTCGGGAGCCAATGTCCTGACCCTTATCGAGAAGGACATCCGTACCCCCAAT
GGC
CTGGCCATCGACCACCGTGCCGAGAAGCTCTACTTCTCTGACGCCACCCTGGACAAGATCGAGCGGT
GC
GAGTATGACGGCTCCCACCGCTATGTGATCCTAAAGTCAGAGCCTGTCCACCCCTTCGGGCTGGCCGT
G
TATGGGGAGCACATTTTCTGGACTGACTGGGTGCGGCGGGCAGTGCAGCGGGCCAACAAGCACGTGGGC
AGC
AACATGAAGCTGCTGCGCGTGGACATCCCCCAGCAGCCCATGGGCATCATCGCCGTGGCCAACGACA
CC
AACAGCTGTGAACTCTCTCCATGCCGAATCAACAACGGTGGCTGCCAGGACCTGTGTCTGCTCACTCA
C
CAGGGCCATGTCAACTGCTCATGCCGAGGGGGCCGAATCCTCCAGGATGACCTCACCTGCCGAGCGGTG
AAT
TCCTCTTGCCGAGCACAAGATGAGTTTGAGTGTGCCAATGGCGAGTGCATCAACTTCAGCCTGACCT
GC
GACGGCGTCCCCCACTGCAAGGACAAGTCCGATGAGAAGCCATCCTACTGCAACTCCCGCCGCTGCAA
G
AAGACTTTCCGGCAGTGCAGCAATGGGCGCTGTGTGTCCAACATGCTGTGGTGCAACGGGGCCGACGAC
TGT
GGGGATGGCTCTGACGAGATCCCTTGCAACAAGACAGCCTGTGGTGTGGGCGAGTTCCGCTGCCGGG
AC
GGGACCTGCATCGGGAACTCCAGCCGCTGCAACCAGTTTGTGGATTGTGAGGACGCCTCAGATGAGAT
G
AACTGCAGTGCCACCGACTGCAGCAGCTACTTCCGCCTGGGCGTGAAGGGCGTGCTCTTCCAGCCCTGC
GAG
CGGACCTCACTCTGCTACGCACCCAGCTGGGTGTGTGATGGCGCCAATGACTGTGGGGACTACAGTG
AT
GAGCGCGACTGCCCAGGTGTGAAACGCCCCAGATGCCCTCTGAATTACTTCGCCTGCCCTAGTGGGCG
C
TGCATCCCCATGAGCTGGACGTGTGACAAAGAGGATGACTGTGAACATGGCGAGGACGAGACCCACTGC
A
AC
AAGTTCTGCTCAGAGGCCCAGTTTGAGTGCCAGAACCATCGCTGCATCTCCAAGCAGTGGCTGTGTG
AC
GGCAGCGATGACTGTGGGGATGGCTCAGACGAGGCTGCTCACTGTGAAGGCAAGACGTGCGGCCCCTC
C
TCCTTCTCCTGCCCTGGCACCCACGTGTGCGTCCCCGAGCGCTGGCTCTGTGACGGTGACAAAGACTGT
GCT
GATGGTGCAGACGAGAGCATCGCAGCTGGTTGCTTGTACAACAGCACTTGTGACGACCGTGAGTTCA
TG
TGCCAGAACCGCCAGTGCATCCCCAAGCACTTCGTGTGTGACCACGACCGTGACTGTGCAGATGGCTC
T
GATGAGTCCCCCGAGTGTGAGTACCCGACCTGCGGCCCCAGTGAGTTCCGCTGTGCCAATGGGCGCTGT
CTG
AGCTCCCGCCAGTGGGAGTGTGATGGCGAGAATGACTGCCACGACCAGAGTGACGAGGCTCCCAAGA
AC
CCACACTGCACCAGCCAAGAGCACAAGTGCAATGCCTCGTCACAGTTCCTGTGCAGCAGTGGGCGCTG
T
GTGGCTGAGGCACTGCTCTGCAACGGCCAGGATGACTGTGGCGACAGCTCGGACGAGCGTGGCTGCCAC
ATC
AATGAGTGTCTCAGCCGCAAGCTCAGTGGCTGCAGCCAGGACTGTGAGGACCTCAAGATCGGCTTCA
AG
TGCCGCTGTCGCCCTGGCTTCCGGCTGAAGGACGACGGCCGGACGTGTGCTGATGTGGACGAGTGCAG
C
ACCACCTTCCCCTGCAGCCAGCGCTGCATCAACACTCATGGCAGCTATAAGTGTCTGTGTGTGGAGGGC
TAT
GCACCCCGCGGCGGCGACCCCCACAGCTGCAAGGCTGTGACTGACGAGGAACCGTTTCTGATCTTCG
CC
AACCGGTACTACCTGCGCAAGCTCAACCTGGACGGGTCCAACTACACGTTACTTAAGCAGGGCCTGAA
C
AACGCCGTTGCCTTGGATTTTGACTACCGAGAGCAGATGATCTACTGGACAGATGTGACCACCCAGGGC
AGC
ATGATCCGAAGGATGCACCTTAACGGGAGCAATGTGCAGGTCCTACACCGTACAGGCCTCAGCAACC
CC
GATGGGCTGGCTGTGGACTGGGTGGGTGGCAACCTGTACTGGTGCGACAAAGGCCGGGACACCATCGA
G
GTGTCCAAGCTCAATGGGGCCTATCGGACGGTGCTGGTCAGCTCTGGCCTCCGTGAGCCCAGGGCTCTG
GTG
GTGGATGTGCAGAATGGGTACCTGTACTGGACAGACTGGGGTGACCATTCACTGATCGGCCGCATCG
GC
ATGGATGGGTCCAGCCGCAGCGTCATCGTGGACACCAAGATCACATGGCCCAATGGCCTGACGCTGGA
C
TATGTCACTGAGCGCATCTACTGGGCCGACGCCCGCGAGGACTACATTGAATTTGCCAGCCTGGATGGC
TCC
AATCGCCACGTTGTGCTGAGCCAGGACATCCCGCACATCTTTGCACTGACCCTGTTTGAGGACTACG
TC
TACTGGACCGACTGGGAAACAAAGTCCATTAACCGAGCCCACAAGACCACGGGCACCAACAAAACGCT
C
CTCATCAGCACGCTGCACCGGCCCATGGACCTGCATGTCTTCCATGCCCTGCGCCAGCCAGACGTGCCC
AAT
CACCCCTGCAAGGTCAACAATGGTGGCTGCAGCAACCTGTGCCTGCTGTCCCCCGGGGGAGGGCACA
AA
TGTGCCTGCCCCACCAACTTCTACCTGGGCAGCGATGGGCGCACCTGTGTGTCCAACTGCACGGCTAG
C
CAGTTTGTATGCAAGAACGACAAGTGCATCCCCTTCTGGTGGAAGTGTGACACCGAGGACGACTGCGGG
GAC
CACTCAGACGAGCCCCCGGACTGCCCTGAGTTCAAGTGCCGGCCCGGACAGTTCCAGTGCTCCACAG
GT
ATCTGCACAAACCCTGCCTTCATCTGCGATGGCGACAATGACTGCCAGGACAACAGTGACGAGGCCAA
C
TGTGACATCCACGTCTGCTTGCCCAGTCAGTTCAAATGCACCAACACCAACCGCTGTATTCCCGGCATC
TTC
CGCTGCAATGGGCAGGACAACTGCGGAGATGGGGAGGATGAGAGGGACTGCCCCGAGGTGACCTGCG
CC
CCCAACCAGTTCCAGTGCTCCATTACCAAACGGTGCATCCCCCGGGTCTGGGTCTGCGACCGGGACAA
T
GACTGTGTGGATGGCAGTGATGAGCCCGCCAACTGCACCCAGATGACCTGTGGTGTGGACGAGTTCCGC
TGC
AAGGATTCGGGCCGCTGCATCCCAGCGCGTTGGAAGTGTGACGGAGAGGATGACTGTGGGGATGGCT
CG
GATGAGCCCAAGGAAGAGTGTGATGAACGCACCTGTGAGCCATACCAGTTCCGCTGCAAGAACAACCG
C
TGCGTGCCCGGCCGCTGGCAGTGCGACTACGACAACGATTGCGGTGACAACTCCGATGAAGAGAGCTGC
A
CC
CCTCGGCCCTGCTCCGAGAGTGAGTTCTCCTGTGCCAACGGCCGCTGCATCGCGGGGCGCTGGAAAT
GC
GATGGAGACCACGACTGCGCGGACGGCTCGGACGAGAAAGACTGCACCCCCCGCTGTGACATGGACCA
G
TTCCAGTGCAAGAGCGGCCACTGCATCCCCCTGCGCTGGCGCTGTGACGCAGACGCCGACTGCATGGAC
GGC
AGCGACGAGGAGGCCTGCGGCACTGGCGTGCGGACCTGCCCCCTGGACGAGTTCCAGTGCAACAACA
CC
TTGTGCAAGCCGCTGGCCTGGAAGTGCGATGGCGAGGATGACTGTGGGGACAACTCAGATGAGAACCC
C
GAGGAGTGTGCCCGGTTCGTGTGCCCTCCCAACCGGCCCTTCCGTTGCAAGAATGACCGCGTCTGTCTG
TGG
ATCGGGCGCCAATGCGATGGCACGGACAACTGTGGGGATGGGACTGATGAAGAGGACTGTGAGCCCC
CC
ACAGCCCACACCACCCACTGCAAAGACAAGAAGGAGTTTCTGTGCCGGAACCAGCGCTGCCTCTCCTC
C
TCCCTGCGCTGCAACATGTTCGATGACTGCGGGGACGGCTCTGACGAGGAGGACTGCAGCATCGACCCC
AAG
CTGACCAGCTGCGCCACCAATGCCAGCATCTGTGGGGACGAGGCACGCTGCGTGCGCACCGAGAAAG
CG
GCCTACTGTGCCTGCCGCTCGGGCTTCCACACCGTGCCCGGCCAGCCCGGATGCCAAGACATCAACGA
G
TGCCTGCGCTTCGGCACCTGCTCCCAGCTCTGCAACAACACCAAGGGCGGCCACCTCTGCAGCTGCGCT
CGG
AACTTCATGAAGACGCACAACACCTGCAAGGCCGAAGGCTCTGAGTACCAGGTCCTGTACATCGCTG
AT
GACAATGAGATCCGCAGCCTGTTCCCCGGCCACCCCCATTCGGCTTACGAGCAGGCATTCCAGGGTGA
C
GAGAGTGTCCGCATTGATGCTATGGATGTCCATGTCAAGGCTGGCCGTGTCTATTGGACCAACTGGCAC
ACG
GGCACCATCTCCTACCGCAGCCTGCCACCTGCTGCGCCTCCTACCACTTCCAACCGCCACCGGCGAC
AG
ATTGACCGGGGTGTCACCCACCTCAACATTTCAGGGCTGAAGATGCCCAGAGGCATCGCCATCGACTG
G
GTGGCCGGAAACGTGTACTGGACCGACTCGGGCCGAGATGTGATTGAGGTGGCGCAGATGAAGGGCGAG
AAC
CGCAAGACGCTCATCTCGGGCATGATTGACGAGCCCCACGCCATTGTGGTGGACCCACTGAGGGGGA
CC
ATGTACTGGTCAGACTGGGGCAACCACCCCAAGATTGAGACGGCAGCGATGGATGGGACGCTTCGGGA
G
ACACTGGTGCAGGACAACATTCAGTGGCCCACAGGCCTGGCCGTGGATTATCACAATGAGCGGCTGTAC
TGG
GCAGACGCCAAGCTTTCAGTCATCGGCAGCATCCGGCTCAATGGCACGGACCCCATTGTGGCTGCTG
AC
AGCAAACGAGGCCTAAGTCACCCCTTCAGCATCGACGTCTTTGAGGATTACATCTATGGTGTCACCTA
C
ATCAATAATCGTGTCTTCAAGATCCATAAGTTTGGCCACAGCCCCTTGGTCAACCTGACAGGGGGCCTG
AGC
CACGCCTCTGACGTGGTCCTTTACCATCAGCACAAGCAGCCCGAAGTGACCAACCCATGTGACCGCA
AG
AAATGCGAGTGGCTCTGCCTGCTGAGCCCCAGTGGGCCTGTCTGCACCTGTCCCAATGGGAAGCGGCT
G
GACAACGGCACATGCGTGCCTGTGCCCTCTCCAACGCCCCCCCCAGATGCTCCCCGGCCTGGAACCTGT
AAC
CTGCAGTGCTTCAACGGTGGCAGCTGTTTCCTCAATGCACGGAGGCAGCCCAAGTGCCGCTGCCAAC
CC
CGCTACACGGGTGACAAGTGTGAACTGGACCAGTGCTGGGAGCACTGTCGCAATGGGGGCACCTGTGC
T
GCCTCCCCCTCTGGCATGCCCACGTGCCGGTGCCCCACGGGCTTCACGGGCCCCAAATGCACCCAGCAG
GTG
TGTGCGGGCTACTGTGCCAACAACAGCACCTGCACTGTCAACCAGGGCAACCAGCCCCAGTGCCGAT
GC
CTACCCGGCTTCCTGGGCGACCGCTGCCAGTACCGGCAGTGCTCTGGCTACTGTGAGAACTTTGGCAC
A
TGCCAGATGGCTGCTGATGGCTCCCGACAATGCCGCTGCACTGCCTACTTTGAGGGATCGAGGTGTGAG
GTG
AACAAGTGCAGCCGCTGTCTCGAAGGGGCCTGTGTGGTCAACAAGCAGAGTGGGGATGTCACCTGCA
A
C
TGCACGGATGGCCGGGTGGCCCCCAGCTGTCTGACCTGCGTCGGCCACTGCAGCAATGGCGGCTCCTG
T
ACCATGAACAGCAAAATGATGCCTGAGTGCCAGTGCCCACCCCACATGACAGGGCCCCGGTGTGAGGAG
CAC
GTCTTCAGCCAGCAGCAGCCAGGACATATAGCCTCCATCCTAATCCCTCTGCTGTTGCTGCTGCTGC
TG
GTTCTGGTGGCCGGAGTGGTATTCTGGTATAAGCGGCGAGTCCAAGGGGCTAAGGGCTTCCAGCACCA
A
CGGATGACCAACGGGGCCATGAACGTGGAGATTGGAAACCCCACCTACAAGATGTACGAAGGCGGAGAG
CCT
GATGATGTGGGAGGCCTACTGGACGCTGACTTTGCCCTGGACCCTGACAAGCCCACCAACTTCACCA
AC
CCCGTGTATGCCACACTCTACATGGGGGGCCATGGCAGTCGCCACTCCCTGGCCAGCACGGACGAGAA
G
CGAGAACTCCTGGGCCGGGGCCCTGAGGACGAGATAGGGGACCCCTTGGCATAG


Translation (4544 aa):
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQ
R
CQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCR
ELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQ
L
QADGKTCK
DFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNIL
A
TYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLH

H
VEQMAIDWLTGNFYFVDDIDDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVER
C
DMDGQNRTKLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGIL
IEHLYGLTVFE
N
YLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPR
VRSHACENDQYGKPGGCS
D
ICLLANSHKARTCRCRSGFSLGSDGKSCK
KPEHELFLVYGKGRPGIIRGMDMGAKVPDEHMIPIENLMN
P
RALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKD
GIHNVEGVAVDWMGDNLYWTDDGPKKTISVA
R
LEKAAQTRKTLIEGKMTHPRAIVVDPLN
GWMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLW
P
NGLSLDIPAGRLYWVDAFYDRIETILLNGTDRK
IVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLER
G
VGGAPPTVTLLRSERPPIFEIRMYDAQQQQ
VGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGV
T
CL
ANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCENNRCIPN
R
WLCDGDNDCGNSEDESNATCS
ARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLT
Q
FTCNNGRCININWRCDN
DNDCGDNSDEAGCSHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHAN
C
TNQ
ATRPPGGCHTDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGVTHVCDPSVKFGCKDSARCIS
K
AWVCDGDNDCEDNSDEENCESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELC
DQCSLNNG
G
CSHNCSVAPGEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES
C
RSL
DPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDNG
A
LTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGDIEHPRAIALDPRDGI
L
FWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLTVDYLEKRILWIDA
RSDAIYSARYDGSGHME
V
LRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPM
APNPC
E
ANGGQGPCSHLCLINYNRTVSCACPHLMKLHKDNTTCY
EFKKFLLYARQMEIRGVDLDAPYYNYIISFT
V
PDIDNVTVLDYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSA
DLPNAHGLAVDWVSRNLFWTSYDTN
K
KQINVARLDGSFKNAVVQGLEQPHGLVVHPLR
GKLYWTDGDNISMANMDGSNRTLLFSGQKGPVGLAID
F
PESKLYWISSGNHTINRCNLDGSGLEVIDAMRSQLGKATALAIM
GDKLWWADQVSEKMGTCSKADGSGS
V
VLRNSTTLVMHMKVYDESIQL
DHKGTNPCSVNNGDCSQLCLPTSETTRSCMCTAGYSLRSGQQACEGVG
S
FLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHA
ENDTIYWVDMGLSTISRAKRDQTWREDVV
T
NGIGRVEGIAVDWIA
GNIYWTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQY
P
RIERSRLDGTERVVLVNVSISWPNGISVDYQ
DGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFS
V
SVFEDFIYWSD
RTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAVANGGCQQLC
L
YRGRGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNLNAPVQPFEDPEHMKNVIALA
F
DYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSRRITIVE
NVGSVEGLAYHRGWDTLYWTSYTTSTITRH
T
VDQTRPGAFERETVITMSGDDHPRAFVLDECQ
NLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPN
G
LAIDHRAEKLYFSDATLDKIERCEYDGSHRY
VILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKHVG
S
NMKLLRVDIPQQPMGIIAVANDTNS
CELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQDDLTCRAV
N
SSCRAQDEFECANGECINFSLTCDGVPHCKDKSDEKPSYC
NSRRCKKTFRQCSNGRCVSNMLWCNGADD
C
GDGSDEIPCN
KTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCSATDCSSYFRLGVKGVLFQPC
E
RTSLCYAPSWVCDGANDCGDYSDERDCP
GVKRPRCPLNYFACPSGRCIPMSWTCDKED