NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8907.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8907.1 Public Homo sapiens 12 SMARCC2 22 109 92 CCDS HistoryNCBI Gene:6601Re-query CCDS DB by CCDS ID:8907.1Re-query CCDS DB by GeneID:6601See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8907.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000267064.8 ENSP00000267064.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000267064.8Link to Ensembl Protein Viewer:ENSP00000267064.4Re-query CCDS DB by Nucleotide ID:ENST00000267064Re-query CCDS DB by Protein ID:ENSP00000267064
Original member NCBI NM_003075.4 NP_003066.2 Updated not alive Link to Nucleotide Sequence:NM_003075.4Link to Protein Sequence:NP_003066.2Re-query CCDS DB by Nucleotide ID:NM_003075Re-query CCDS DB by Protein ID:NP_003066
Current member NCBI NM_003075.5 NP_003066.2 Accepted alive Link to Nucleotide Sequence:NM_003075.5Link to Protein Sequence:NP_003066.2Re-query CCDS DB by Nucleotide ID:NM_003075Re-query CCDS DB by Protein ID:NP_003066Link to BLAST:NP_003066.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003066.2 1214 Q8TAQ2-1 1214 100% 0 0

Chromosomal Locations for CCDS 8907.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 56163689 56163765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56164303 56164731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56165318 56165699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56168060 56168194 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56169529 56169695 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56169776 56169911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56170144 56170208 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56171271 56171432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56171679 56171937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56172428 56172490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56172585 56172704 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56173696 56173849 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56174651 56174764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56178022 56178093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56178404 56178534 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56178810 56178847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56178997 56179056 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56180977 56181101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56181482 56181597 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56181704 56181835 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56182004 56182079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56183861 56183930 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56184175 56184244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56184844 56184936 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56185030 56185111 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56186155 56186240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56187187 56187306 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56189351 56189461 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3645 nt):
ATGGCGGTGCGGAAGAAGGACGGCGGCCCCAACGTGAAGTACTACGAGGCCGCGGACACCGTGACCCAGT
TC
GACAACGTGCGGCTGTGGCTCGGCAAGAACTACAAGAAGTATATACAAGCTGAACCACCCACCAACAA
G
TCCCTGTCTAGCCTGGTTGTACAGTTGCTACAATTTCAGGAAGAAGTTTTTGGCAAACATGTCAGCAAT
GCA
CCGCTCACTAAACTGCCGATCAAATGTTTCCTAGATTTCAAAGCGGGAGGCTCCTTGTGCCACATTC
TT
GCAGCTGCCTACAAATTCAAGAGTGACCAGGGATGGCGGCGTTACGATTTCCAGAATCCATCACGCAT
G
GACCGCAATGTGGAAATGTTTATGACCATTGAGAAGTCCTTGGTGCAGAATAATTGCCTGTCTCGACCT
AAC
ATTTTTCTGTGCCCAGAAATTGAGCCCAAACTACTAGGGAAATTAAAGGACATTATCAAGAGACACC
AG
GGAACAGTCACTGAGGATAAGAACAATGCCTCCCATGTTGTGTATCCTGTCCCGGGGAATCTAGAAGA
A
GAGGAATGGGTACGACCAGTCATGAAGAGGGATAAGCAGGTTCTTCTGCACTGGGGCTACTATCCTGAC
AG
T
TACGACACGTGGATCCCAGCGAGTGAAATTGAGGCATCTGTGGAAGATGCTCCAACTCCTGAGAAAC
CT
AGGAAGGTTCATGCAAAGTGGATCCTGGACACCGACACCTTCAATGAATGGATGAATGAGGAAGACTA
T
GAAGTAAATGATGACAAAAACCCTGTCTCCCGCCGAAAGAAGATTTCAGCCAAGACACTGACAGATGAG
GTG
AACAGCCCAGATTCAGATCGACGGGACAAGAAGGGGGGAAACTATAAGAAGAGGAAGCGCTCCCCCT
CT
CCTTCACCAACCCCAGAAGCAAAGAAGAAAAATGCTAAGAAAGGTCCCTCAACACCTTACACTAAGTC
A
AAGCGTGGCCACAGAGAAGAGGAGCAAGAAGACCTGACAAAGGACATGGACGAGCCCTCACCAGTCCCC
AAT
GTAGAAGAGGTGACACTTCCCAAAACAGTCAACACAAAGAAAGACTCAGAGTCGGCCCCAGTCAAAG
GC
GGCACCATGACCGACCTGGATGAACAGGAAGATGAAAGCATGGAGACGACGGGCAAGGATGAGGATGA
G
AACAGTACGGGGAACAAGGGAGAGCAGACCAAGAATCCAGACCTGCATGAGGACAATGTGACTGAACAG
ACC
CACCACATCATCATTCCCAGCTACGCTGCCTGGTTTGACTACAATAGTGTTCATGCCATTGAGCGGA
GG
GCTCTCCCCGAGTTCTTCAACGGCAAGAACAAGTCCAAGACTCCAGAGATCTACCTGGCCTATCGAAA
C
TTTATGATTGACACTTACCGACTGAACCCCCAAGAGTATCTTACCTCTACCGCCTGCCGCCGAAACCTA
GCG
GGTGATGTCTGTGCCATCATGAGGGTCCATGCCTTCCTAGAACAGTGGGGTCTTATTAACTACCAGG
TG
GATGCTGAGAGTCGACCAACCCCAATGGGGCCTCCGCCTACCTCTCACTTCCATGTCTTGGCTGACAC
A
CCATCAGGGCTGGTGCCTCTGCAGCCCAAGACACCTCAGCAGACCTCTGCTTCCCAACAAATGCTCAAC
TTT
CCTGACAAAGGCAAAGAGAAACCAACAGACATGCAAAACTTTGGGCTGCGCACAGACATGTACACAA
AA
AAGAATGTTCCCTCCAAGAGCAAGGCTGCAGCCAGTGCCACTCGTGAGTGGACAGAACAGGAAACCCT
G
CTTCTCCTGGAGGCACTGGAAATGTACAAAGATGACTGGAACAAAGTGTCCGAGCATGTGGGAAGCCGC
ACA
CAGGACGAGTGCATCTTGCATTTTCTTCGTCTTCCCATTGAAGACCCATACCTGGAGGACTCAGAGG
CC
TCCCTAGGCCCCCTGGCCTACCAACCCATCCCCTTCAGTCAGTCGGGCAACCCTGTTATGAGCACTGT
T
GCCTTCCTGGCCTCTGTCGTCGATCCCCGAGTCGCCTCTGCTGCTGCAAAGTCAGCCCTAGAGGAGTTC
TCC
AAAATGAAGGAAGAGGTACCCACGGCCTTGGTGGAGGCCCATGTTCGAAAAGTGGAAGAAGCAGCCA
AA
GTAACAGGCAAGGCGGACCCTGCCTTCGGTCTGGAAAGCAGTGGCATTGCAGGAACCACCTCTGATGA
G
CCTGAGCGGATTGAGGAGAGCGGGAATGACGAGGCTCGGGTGGAAGGCCAGGCCACAGATGAGAAGAAG
GAG
CCCAAGGAACCCCGAGAAGGAGGGGGTGCTATAGAGGAGGAAGCAAAAGAGAAAACCAGCGAGGCTC
CC
AAGAAGGATGAGGAGAAAGGGAAAGAAGGCGACAGTGAGAAGGAGTCCGAGAAGAGTGATGGAGACCC
A
ATAGTCGATCCTGAGAAGGAGAAGGAGCCAAAGGAAGGGCAGGAGGAAGTGCTGAAGGAAGTGGTGGAG
TCT
GAGGGGGAAAGGAAGACAAAGGTGGAGCGGGACATTGGCGAGGGCAACCTCTCCACCGCTGCTGCCG
CC
GCCCTGGCCGCCGCCGCAGTGAAAGCTAAGCACTTGGCTGCTGTTGAGGAAAGGAAGATCAAATCTTT
G
GTGGCCCTGCTGGTGGAGACCCAGATGAAAAAGTTGGAGATCAAACTTCGGCACTTTGAGGAGCTGGAG
ACT
ATCATGGACCGGGAGCGAGAAGCACTGGAGTATCAGAGGCAGCAGCTCCTGGCCGACAGACAAGCCT
TC
CACATGGAGCAGCTGAAGTATGCGGAGATGAGGGCTCGGCAGCAGCACTTCCAACAGATGCACCAACA
G
CAGCAGCAGCCACCACCAGCCCTGCCCCCAGGCTCCCAGCCTATCCCCCCAACAGGGGCTGCTGGGCCA
CCC
GCAGTCCATGGCTTGGCTGTGGCTCCAGCCTCTGTAGTCCCTGCTCCTGCTGGCAGTGGGGCCCCTC
CA
GGAAGTTTGGGCCCTTCTGAACAGATTGGGCAGGCAGGGTCAACTGCAGGGCCACAGCAGCAGCAACC
A
GCTGGAGCCCCCCAGCCTGGGGCAGTCCCACCAGGGGTTCCCCCCCCTGGACCCCATGGCCCCTCACCG
TTC
CCCAACCAACAAACTCCTCCCTCAATGATGCCAGGGGCAGTGCCAGGCAGCGGGCACCCAGGCGTGG
CG
GGTAATGCTCCTTTGGGTTTGCCTTTTGGCATGCCGCCTCCTCCTCCTCCTCCTGCTCCATCCATCAT
C
CCATTTGGTAGTCTAGCTGACTCCATCAGTATTAACCTCCCCGCTCCTCCTAACCTGCATGGGCATCAC
CAC
CATCTCCCGTTCGCCCCGGGCACTCTCCCCCCACCTAACCTGCCTGTGTCCATGGCGAACCCTCTAC
AT
CCTAACCTGCCGGCGACCACCACCATGCCATCTTCCTTGCCTCTCGGGCCGGGGCTCGGATCCGCCGC
A
GCCCAAAGCCCTGCCATTGTGGCAGCTGTTCAGGGCAACCTCCTGCCCAGTGCCAGCCCACTGCCAGAC
CCA
GGCACCCCCCTGCCTCCAGACCCCACAGCCCCGAGCCCAGGCACGGTCACCCCTGTGCCACCTCCAC
AG
TGA


Translation (1214 aa):
MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSN
A
PLTKLP
IKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRP
N
IFLCPEIEPKLLGKLKDIIKRHQ
GTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPD
S
YDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDE
V
NSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKK
GPSTPYTKSKRGHREEEQEDLTKDMDEPSPVP
N
VEEVTLPKT
VNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQ
T
HHIIIPSYAAWFDYN
SVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNL
A
GDVCAIM
RVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQQTSASQQMLN
F
PDKGKEKPTDMQNFGLRTDMYTKKNVPSK
SKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSR
T
QDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSAL
EEF
S
KMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTTSDEPERI
EESGNDEARVEGQATDEKK
E
PK
EPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVE
S
EGERKTKVERDIGEGNLSTAAAAALAAAAVKAK
HLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELE
T
IMDREREA
LEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQPPPALPPGSQPIPPTGAAGP
P
AVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTAGPQQQQPAGAPQPGAVPPGVPPPGPH
GPSP
F
PNQQTPPSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHH
H
HLPFAPGTLPPPNLPVSMANPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLP
D
P
GTPLPPDPTAPSPGTVTPVPPPQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser