NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8847.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8847.1 Public Homo sapiens 12 SOAT2 22 109 92 CCDS HistoryNCBI Gene:8435Re-query CCDS DB by CCDS ID:8847.1Re-query CCDS DB by GeneID:8435See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8847.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000301466.7 ENSP00000301466.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000301466.7Link to Ensembl Protein Viewer:ENSP00000301466.3Re-query CCDS DB by Nucleotide ID:ENST00000301466Re-query CCDS DB by Protein ID:ENSP00000301466
Original member Current member NCBI NM_003578.3 NP_003569.1 Accepted alive Link to Nucleotide Sequence:NM_003578.3Link to Protein Sequence:NP_003569.1Re-query CCDS DB by Nucleotide ID:NM_003578Re-query CCDS DB by Protein ID:NP_003569Link to BLAST:NP_003569.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003569.1 522 O75908-1 522 100% 0 0

Chromosomal Locations for CCDS 8847.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 53103578 53103659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53104151 53104206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53105107 53105243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53105561 53105620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53105907 53106014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53115390 53115654 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53116097 53116166 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53118350 53118434 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53118890 53118935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53119124 53119253 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53120786 53120883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53121303 53121401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53123081 53123216 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53123728 53123873 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53124073 53124123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1569 nt):
ATGGAGCCAGGCGGGGCCCGTCTGCGTCTGCAGAGGACAGAAGGGCTGGGAGGGGAGCGGGAGCGCCAAC
CC
TGTGGAGATGGAAACACTGAGACGCACAGAGCCCCGGACTTGGTACAATGGACCCGACACATGGAGGC
T
GTGAAGGCACAATTGCTGGAGCAAGCGCAGGGACAACTGAGGGAGCTGCTGGATCGGGCCATGCGGGAG
GCT
ATACAATCCTACCCATCACAAGACAAACCTCTGCCCCCACCTCCCCCAGGTTCCTTGAGCAGGACCC
AG
GAGCCATCCCTGGGGAAACAGAAAGTTTTCATCATCCGCAAGTCCCTGCTTGATGAGCTGATGGAGGT
G
CAGCATTTCCGCACCATCTACCACATGTTCATCGCTGGCCTGTGTGTCTTCATCATCAGCACCCTGGCC
ATC
GACTTCATTGATGAGGGCAGGCTGCTGCTGGAGTTTGACCTACTGATCTTCAGCTTCGGACAGCTGC
CA
TTGGCGCTGGTGACCTGGGTGCCCATGTTTCTGTCCACCCTGTTGGCGCCGTACCAGGCCCTACGGCT
G
TGGGCCAGGGGCACCTGGACGCAGGCGACGGGCCTGGGCTGTGCGCTGCTAGCCGCCCACGCCGTGGTG
CTC
TGCGCGCTGCCGGTCCACGTGGCCGTGGAGCATCAGCTCCCGCCGGCCTCCCGTTGTGTCCTGGTCT
TC
GAGCAGGTTAGGTTCCTGATGAAAAGCTACTCCTTCCTGAGAGAGGCTGTGCCTGGGACCCTTCGTGC
C
AGACGAGGTGAGGGGATCCAGGCCCCCAGTTTCTCCAGCTACCTCTACTTCCTCTTCTGCCCAACACTC
ATC
TACAGGGAGACTTACCCTAGGACGCCCTATGTCAGGTGGAATTATGTGGCCAAGAACTTTGCCCAGG
CC
CTGGGATGTGTGCTCTATGCCTGCTTCATCCTGGGCCGCCTCTGTGTTCCTGTCTTTGCCAACATGAG
C
CGAGAGCCCTTCAGCACCCGTGCCCTGGTGCTCTCTATCCTGCATGCCACGTTGCCAGGCATCTTCATG
CTG
CTGCTCATCTTCTTTGCCTTCCTCCATTGCTGGCTCAACGCCTTTGCCGAGATGCTACGATTTGGAG
AC
AGGATGTTCTACCGGGACTGGTGGAACTCAACGTCCTTCTCCAACTACTACCGCACTTGGAACGTGGT
G
GTCCATGACTGGCTGTACAGCTACGTGTATCAGGATGGGCTGCGGCTCCTTGGTGCCCGGGCCCGAGGG
GTA
GCCATGCTGGGTGTGTTCCTGGTCTCCGCAGTGGCCCATGAGTATATCTTCTGCTTCGTCCTGGGGT
TC
TTCTATCCCGTCATGCTGATACTCTTCCTTGTCATTGGAGGAATGTTGAACTTCATGATGCATGACCA
G
CGCACCGGCCCGGCATGGAACGTGCTGATGTGGACCATGCTGTTTCTAGGCCAGGGAATCCAGGTCAGC
CTG
TACTGCCAGGAGTGGTACGCACGGCGGCACTGCCCCTTACCCCAGGCAACTTTCTGGGGGCTGGTGA
CA
CCTCGATCTTGGTCCTGCCATACCTAG


Translation (522 aa):
MEPGGARLRLQRTEGLGGERERQPCGDGNTETHRAPDLVQWTRHMEAVKAQLLEQAQGQLRELLDRAMRE
A
IQSYPSQDKPLPPPPPGSLS
RTQEPSLGKQKVFIIRKSLLDELMEVQHFRTIYHMFIAGLCVFIISTLA
I
DFIDEG
RLLLEFDLLIFSFGQLPLALVTWVPMFLSTLLAPYQALRLWARGTWTQATGLGCALLAAHAVV
L
CALPVHVAVEHQLPPASRCVLVFEQ
VRFLMKSYSFLREAVPGTLRARRGEGIQAPSFSSYLYFLFCPTL
I
YRETYP
RTPYVRWNYVAKNFAQALGCVLYACFILGRLCVPVFANMSREPFSTRALVLSILHATLPGIFM
L
LLIFFAFLHCWLNAFAEMLRFGDRMFYR
DWWNSTSFSNYYRTWNVVVHDWLYSYVYQDGLRLLGARARG
V
AMLGVFLVSAVAHEYIFCFVLGFFYPVMLILFLVIG
GMLNFMMHDQRTGPAWNVLMWTMLFLGQGIQVS
L
YCQEWYARRHCPLPQ
ATFWGLVTPRSWSCHT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser