NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8801.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8801.1 Public Homo sapiens 12 CERS5 22 109 92 CCDS HistoryNCBI Gene:91012Re-query CCDS DB by CCDS ID:8801.1Re-query CCDS DB by GeneID:91012See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8801.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000317551.10 ENSP00000325485.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000317551.10Link to Ensembl Protein Viewer:ENSP00000325485.6Re-query CCDS DB by Nucleotide ID:ENST00000317551Re-query CCDS DB by Protein ID:ENSP00000325485
Original member NCBI NM_147190.3 NP_671723.1 Updated not alive Link to Nucleotide Sequence:NM_147190.3Link to Protein Sequence:NP_671723.1Re-query CCDS DB by Nucleotide ID:NM_147190Re-query CCDS DB by Protein ID:NP_671723
NCBI NM_147190.4 NP_671723.1 Updated not alive Link to Nucleotide Sequence:NM_147190.4Link to Protein Sequence:NP_671723.1Re-query CCDS DB by Nucleotide ID:NM_147190Re-query CCDS DB by Protein ID:NP_671723
Current member NCBI NM_147190.5 NP_671723.1 Accepted alive Link to Nucleotide Sequence:NM_147190.5Link to Protein Sequence:NP_671723.1Re-query CCDS DB by Nucleotide ID:NM_147190Re-query CCDS DB by Protein ID:NP_671723Link to BLAST:NP_671723.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_671723.1 392 Q8N5B7-1 392 100% 0 0

Chromosomal Locations for CCDS 8801.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 50130545 50130694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 50134546 50134702 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 50135732 50135838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 50135941 50136069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 50137728 50137820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 50138567 50138617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 50142053 50142110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 50143074 50143204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 50143952 50144057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 50167101 50167297 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1179 nt):
ATGGCGACAGCAGCGCAGGGACCCCTAAGCTTGCTGTGGGGCTGGCTGTGGAGCGAGCGCTTCTGGCTAC
CC
GAGAACGTGAGCTGGGCTGATCTGGAGGGGCCGGCCGACGGCTACGGTTACCCCCGCGGCCGGCACAT
C
CTCTCGGTGTTCCCGCTGGCGGCGGGCATCTTCTTCGTGAGGCTGCTCTTCGAGCGATTTATTGCCAAA
CCC
TGTGCACTCTGTATTGGCATCGAGGACAGTGGTCCTTATCAGGCCCAACCCAATGCCATCCTTGAAA
AG
GTGTTCATATCTATTACCAAGTATCCTGATAAGAAAAGGCTGGAGGGCCTGTCAAAGCAGCTGGATTG
G
AATGTCCGAAAAATCCAATGCTGGTTTCGCCATCGGAGGAATCAGGACAAGCCCCCAACGCTTACTAAA
TTC
TGTGAAAGCATGTGGAGATTCACATTTTATTTATGTATATTCTGCTATGGAATTAGATTTCTCTGGT
CG
TCACCTTGGTTCTGGGACATCCGACAGTGCTGGCATAACTATCCATTTCAGCCTCTTTCAAGTGGGCT
T
TATCACTATTATATCATGGAATTGGCCTTCTATTGGTCCCTTATGTTTTCTCAGTTTACAGACATTAAA
AGA
AAGGACTTCCTGATCATGTTTGTGCATCACTTGGTCACCATTGGGCTTATCTCCTTCTCCTACATCA
AC
AATATGGTTCGAGTGGGAACTCTGATCATGTGTCTACATGATGTCTCAGACTTCTTGCTGGAGGCAGC
C
AAACTGGCCAATTATGCCAAGTATCAGCGGCTCTGTGACACCCTTTTTGTGATCTTCAGTGCTGTTTTT
ATG
GTTACACGACTAGGAATCTATCCATTCTGGATTCTGAACACGACCCTCTTTGAGAGTTGGGAGATAA
TC
GGGCCTTATGCTTCATGGTGGCTCCTCAATGGCCTGCTGCTGACCCTACAGCTTCTGCATGTCATCTG
G
TCCTACCTAATTGCACGGATTGCTTTGAAAGCCTTGATCAGGGGAAAGGTATCGAAGGATGATCGCAGT
GAT
GTGGAGAGCAGCTCAGAGGAAGAAGATGTGACCACCTGCACAAAAAGTCCCTGTGACAGTAGCTCCA
GC
AATGGTGCCAATCGGGTGAATGGTCACATGGGAGGCAGCTACTGGGCTGAAGAGTAA


Translation (392 aa):
MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFVRLLFERFIAK
P
CALCIGIEDSGPYQAQPNAILEKVFISITK
YPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTK
F
CES
MWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPFQPLSSGLYHYYIMELAFYWSLMFSQFTDIK
R
K
DFLIMFVHHLVTIGLISFSYINNMVRVGTLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVF
M
VTRLGIYPF
WILNTTLFESWEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRS
D
VESSSEEEDVTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser