NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS87242.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
87242.1 Public Homo sapiens 4 MAPK10 22 109 92 CCDS HistoryNCBI Gene:5602Re-query CCDS DB by CCDS ID:87242.1Re-query CCDS DB by GeneID:5602See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 22, NCBI annotation release 109, Ensembl annotation release 92

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 87242.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000359221.8 ENSP00000352157.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000359221.8Link to Ensembl Protein Viewer:ENSP00000352157.4Re-query CCDS DB by Nucleotide ID:ENST00000359221Re-query CCDS DB by Protein ID:ENSP00000352157
Original member Current member EBI ENST00000512689.6 ENSP00000425654.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000512689.6Link to Ensembl Protein Viewer:ENSP00000425654.2Re-query CCDS DB by Nucleotide ID:ENST00000512689Re-query CCDS DB by Protein ID:ENSP00000425654
Original member Current member EBI ENST00000640490.1 ENSP00000492484.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000640490.1Link to Ensembl Protein Viewer:ENSP00000492484.1Re-query CCDS DB by Nucleotide ID:ENST00000640490Re-query CCDS DB by Protein ID:ENSP00000492484
Original member Current member EBI ENST00000639972.2 ENSP00000492809.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000639972.2Link to Ensembl Protein Viewer:ENSP00000492809.1Re-query CCDS DB by Nucleotide ID:ENST00000639972Re-query CCDS DB by Protein ID:ENSP00000492809
Original member Current member EBI ENST00000641430.1 ENSP00000492972.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641430.1Link to Ensembl Protein Viewer:ENSP00000492972.1Re-query CCDS DB by Nucleotide ID:ENST00000641430Re-query CCDS DB by Protein ID:ENSP00000492972
Original member Current member EBI ENST00000641313.1 ENSP00000493204.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641313.1Link to Ensembl Protein Viewer:ENSP00000493204.1Re-query CCDS DB by Nucleotide ID:ENST00000641313Re-query CCDS DB by Protein ID:ENSP00000493204
Original member Current member EBI ENST00000641989.1 ENSP00000493206.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641989.1Link to Ensembl Protein Viewer:ENSP00000493206.1Re-query CCDS DB by Nucleotide ID:ENST00000641989Re-query CCDS DB by Protein ID:ENSP00000493206
Original member Current member EBI ENST00000641237.1 ENSP00000493215.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641237.1Link to Ensembl Protein Viewer:ENSP00000493215.1Re-query CCDS DB by Nucleotide ID:ENST00000641237Re-query CCDS DB by Protein ID:ENSP00000493215
Original member Current member EBI ENST00000641767.1 ENSP00000493309.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641767.1Link to Ensembl Protein Viewer:ENSP00000493309.1Re-query CCDS DB by Nucleotide ID:ENST00000641767Re-query CCDS DB by Protein ID:ENSP00000493309
Original member Current member EBI ENST00000641537.1 ENSP00000493329.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641537.1Link to Ensembl Protein Viewer:ENSP00000493329.1Re-query CCDS DB by Nucleotide ID:ENST00000641537Re-query CCDS DB by Protein ID:ENSP00000493329
Original member Current member EBI ENST00000642032.1 ENSP00000493373.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000642032.1Link to Ensembl Protein Viewer:ENSP00000493373.1Re-query CCDS DB by Nucleotide ID:ENST00000642032Re-query CCDS DB by Protein ID:ENSP00000493373
Original member Current member EBI ENST00000641555.1 ENSP00000493395.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641555.1Link to Ensembl Protein Viewer:ENSP00000493395.1Re-query CCDS DB by Nucleotide ID:ENST00000641555Re-query CCDS DB by Protein ID:ENSP00000493395
Original member NCBI NM_001351625.1 NP_001338554.1 Updated not alive Link to Nucleotide Sequence:NM_001351625.1Link to Protein Sequence:NP_001338554.1Re-query CCDS DB by Nucleotide ID:NM_001351625Re-query CCDS DB by Protein ID:NP_001338554
NCBI NM_001351625.2 NP_001338554.1 Updated not alive Link to Nucleotide Sequence:NM_001351625.2Link to Protein Sequence:NP_001338554.1Re-query CCDS DB by Nucleotide ID:NM_001351625Re-query CCDS DB by Protein ID:NP_001338554
Current member NCBI NM_001351625.3 NP_001338554.1 Accepted alive Link to Nucleotide Sequence:NM_001351625.3Link to Protein Sequence:NP_001338554.1Re-query CCDS DB by Nucleotide ID:NM_001351625Re-query CCDS DB by Protein ID:NP_001338554Link to BLAST:NP_001338554.1

Chromosomal Locations for CCDS 87242.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 86017359 86017375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86029197 86029274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86031368 86031431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86064266 86064390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86067773 86067955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86098524 86098595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86101052 86101217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86101894 86102032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86103186 86103244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86107223 86107352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86159298 86159419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1155 nt):
ATGAGCAAAAGCAAAGTTGACAACCAGTTCTACAGTGTGGAAGTGGGAGACTCAACCTTCACAGTTCTCA
AG
CGCTACCAGAATCTAAAGCCTATTGGCTCTGGGGCTCAGGGCATAGTTTGTGCCGCGTATGATGCTGT
C
CTTGACAGAAATGTGGCCATTAAGAAGCTCAGCAGACCCTTTCAGAACCAAACACATGCCAAGAGAGCG
TAC
CGGGAGCTGGTCCTCATGAAGTGTGTGAACCATAAAAACATTATTAGTTTATTAAATGTCTTCACAC
CC
CAGAAAACGCTGGAGGAGTTCCAAGATGTTTACTTAGTAATGGAACTGATGGATGCCAACTTATGTCA
A
GTGATTCAGATGGAATTAGACCATGAGCGAATGTCTTACCTGCTGTACCAAATGTTGTGTGGCATTAAG
CAC
CTCCATTCTGCTGGAATTATTCACAGGGATTTAAAACCAAGTAACATTGTAGTCAAGTCTGATTGCA
CA
TTGAAAATCCTGGACTTTGGACTGGCCAGGACAGCAGGCACAAGCTTCATGATGACTCCATATGTGGT
G
ACACGTTATTACAGAGCCCCTGAGGTCATCCTGGGGATGGGCTACAAGGAGAACGTGGATATATGGTCT
GTG
GGATGCATTATGGGAGAAATGGTTCGCCACAAAATCCTCTTTCCAGGAAGGGACTATATTGACCAGT
GG
AATAAGGTAATTGAACAACTAGGAACACCATGTCCAGAATTCATGAAGAAATTGCAACCCACAGTAAG
A
AACTATGTGGAGAATCGGCCCAAGTATGCGGGACTCACCTTCCCCAAACTCTTCCCAGATTCCCTCTTC
CCA
GCGGACTCCGAGCACAATAAACTCAAAGCCAGCCAAGCCAGGGACTTGTTGTCAAAGATGCTAGTGA
TT
GACCCAGCAAAAAGAATATCAGTGGACGACGCCTTACAGCATCCCTACATCAACGTCTGGTATGACCC
A
GCCGAAGTGGAGGCGCCTCCACCTCAGATATATGACAAGCAGTTGGATGAAAGAGAACACACAATTGAA
GAA
TGGAAAGAACTTATCTACAAGGAAGTAATGAATTCAGAAGAAAAGACTAAAAATGGTGTAGTAAAAG
GA
CAGCCTTCTCCTTCAGCACAGGTGCAGCAGTGA


Translation (384 aa):
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRA
Y
RELVLMKCVNHKN
IISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIK
H
LHSAGIIHR
DLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWS
V
GCIMGEMVRHKILFPGRD
YIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLF
P
ADSEHNKLK
ASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIE
E
WK
ELIYKEVMNSEEKTKNGVVKGQPSPSAQVQQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser