NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8698.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8698.1 Reviewed, update pending Homo sapiens 12 ETNK1 22 109 92 CCDS HistoryNCBI Gene:55500Re-query CCDS DB by CCDS ID:8698.1Re-query CCDS DB by GeneID:55500See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 8698.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000266517.8 ENSP00000266517.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000266517.8Link to Ensembl Protein Viewer:ENSP00000266517.3Re-query CCDS DB by Nucleotide ID:ENST00000266517Re-query CCDS DB by Protein ID:ENSP00000266517
Original member NCBI NM_018638.4 NP_061108.2 Updated not alive Link to Nucleotide Sequence:NM_018638.4Link to Protein Sequence:NP_061108.2Re-query CCDS DB by Nucleotide ID:NM_018638Re-query CCDS DB by Protein ID:NP_061108
Current member NCBI NM_018638.5 NP_061108.3 Pending alive Link to Nucleotide Sequence:NM_018638.5Link to Protein Sequence:NP_061108.3Re-query CCDS DB by Nucleotide ID:NM_018638Re-query CCDS DB by Protein ID:NP_061108Link to BLAST:NP_061108.3

Chromosomal Locations for CCDS 8698.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 22625164 22625586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 22643763 22644022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 22659014 22659154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 22661063 22661205 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 22671272 22671355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 22673500 22673660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 22684483 22684556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 22684882 22684954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1359 nt):
ATGCTCTGCGGCCGCCCGCGGTCCAGCTCCGACAACAGGAATTTTCTCCGAGAGCGGGCCGGGCTCAGTT
CA
GCTGCTGTCCAGACCCGGATCGGCAACAGTGCCGCCTCCAGACGTTCTCCTGCCGCTCGCCCGCCCGT
C
CCAGCGCCCCCAGCCCTCCCGCGAGGGCGCCCCGGGACGGAAGGATCCACCAGTCTGTCGGCGCCCGCC
GTT
CTCGTGGTCGCCGTCGCCGTCGTCGTGGTGGTAGTCTCCGCCGTCGCCTGGGCCATGGCCAATTACA
TC
CACGTCCCTCCCGGCTCCCCGGAGGTGCCCAAGCTGAACGTCACCGTTCAGGATCAGGAGGAGCATCG
C
TGCCGGGAGGGGGCCCTGAGCCTCCTGCAACACCTGCGGCCTCACTGGGACCCCCAGGAGGTGACCCTG
CAG
CTCTTCACAGATGGAATCACAAATAAACTTATTGGCTGTTACGTGGGAAACACCATGGAGGATGTAG
TC
CTGGTGAGAATTTATGGCAATAAGACTGAGTTATTAGTCGATCGAGATGAGGAAGTAAAGAGTTTTCG
A
GTGTTGCAGGCTCATGGGTGTGCACCACAACTCTACTGTACCTTCAATAATGGACTATGCTATGAATTT
ATA
CAAGGAGAAGCACTGGATCCAAAGCATGTCTGCAACCCAGCCATTTTCAGGCTAATAGCTCGTCAGC
TT
GCTAAAATCCATGCTATTCATGCACACAATGGCTGGATCCCCAAATCTAATCTTTGGCTAAAGATGGG
A
AAGTATTTCTCTCTCATTCCCACAGGATTTGCAGATGAAGACATTAATAAAAGGTTCCTAAGTGATATC
CCA
AGCTCTCAGATTCTCCAGGAAGAGATGACTTGGATGAAGGAGATTCTTTCCAACCTGGGCTCACCTG
TT
GTGCTTTGCCATAATGACCTATTGTGTAAGAATATAATCTACAATGAGAAACAAGGTGATGTACAGTT
C
ATTGATTATGAATATTCTGGATACAACTACCTGGCATATGATATTGGAAATCATTTCAATGAATTTGCA
G
GT
GTGAGTGATGTAGACTATAGTCTGTATCCAGATAGAGAACTACAGAGTCAGTGGCTGCGTGCTTACC
TT
GAAGCCTACAAAGAATTTAAGGGCTTTGGGACTGAAGTTACTGAAAAGGAGGTAGAAATACTCTTCAT
T
CAAGTCAATCAGTTTGCATTGGCTTCTCATTTCTTTTGGGGATTGTGGGCTTTGATTCAAGCCAAATAC
TCC
ACTATTGAGTTTGATTTCCTTGGGTATGCAATTGTTCGTTTTAACCAGTACTTTAAAATGAAGCCTG
AG
GTTACTGCATTAAAAGTGCCTGAGTAA


Translation (452 aa):
MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPA
V
LVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTL
Q
LFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEF
I
QGEALDPKHVCNPAIF
RLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADEDINKRFLSDI
P
SSQILQEEMTWMKEILSNLGSPVVLCHNDLLCKNIIYNEKQ
GDVQFIDYEYSGYNYLAYDIGNHFNEFA
G
VSDVDYSLYPDRELQSQWLRAYLEAYKEFKGFGTEVTEKEVEILFIQVNQFALASHFFWGLWALIQAKY
S
TIEFDFL
GYAIVRFNQYFKMKPEVTALKVPE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser