NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8510.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8510.1 Public Homo sapiens 12 WNT5B 22 109 92 CCDS HistoryNCBI Gene:81029Re-query CCDS DB by CCDS ID:8510.1Re-query CCDS DB by GeneID:81029See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8510.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000310594.7 ENSP00000308887.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000310594.7Link to Ensembl Protein Viewer:ENSP00000308887.3Re-query CCDS DB by Nucleotide ID:ENST00000310594Re-query CCDS DB by Protein ID:ENSP00000308887
Original member Current member EBI ENST00000397196.6 ENSP00000380379.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397196.6Link to Ensembl Protein Viewer:ENSP00000380379.2Re-query CCDS DB by Nucleotide ID:ENST00000397196Re-query CCDS DB by Protein ID:ENSP00000380379
Original member Current member EBI ENST00000537031.5 ENSP00000439312.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000537031.5Link to Ensembl Protein Viewer:ENSP00000439312.1Re-query CCDS DB by Nucleotide ID:ENST00000537031Re-query CCDS DB by Protein ID:ENSP00000439312
Original member Current member NCBI NM_030775.2 NP_110402.2 Accepted alive Link to Nucleotide Sequence:NM_030775.2Link to Protein Sequence:NP_110402.2Re-query CCDS DB by Nucleotide ID:NM_030775Re-query CCDS DB by Protein ID:NP_110402Link to BLAST:NP_110402.2
Original member NCBI NM_032642.2 NP_116031.1 Updated not alive Link to Nucleotide Sequence:NM_032642.2Link to Protein Sequence:NP_116031.1Re-query CCDS DB by Nucleotide ID:NM_032642Re-query CCDS DB by Protein ID:NP_116031
Current member NCBI NM_032642.3 NP_116031.1 Accepted alive Link to Nucleotide Sequence:NM_032642.3Link to Protein Sequence:NP_116031.1Re-query CCDS DB by Nucleotide ID:NM_032642Re-query CCDS DB by Protein ID:NP_116031Link to BLAST:NP_116031.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_110402.2 359 Q9H1J7 359 100% 0 0
NP_116031.1 359 Q9H1J7 359 100% 0 0

Chromosomal Locations for CCDS 8510.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 1631355 1631434 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 1632658 1632905 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 1639684 1639976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 1645794 1646252 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGCCCAGCCTGCTGCTGCTGTTCACGGCTGCTCTGCTGTCCAGCTGGGCTCAGCTTCTGACAGACGCCA
AC
TCCTGGTGGTCATTAGCTTTGAACCCGGTGCAGAGACCCGAGATGTTTATCATCGGTGCCCAGCCCGT
G
TGCAGTCAGCTTCCCGGGCTCTCCCCTGGCCAGAGGAAGCTGTGCCAATTGTACCAGGAGCACATGGCC
TAC
ATAGGGGAGGGAGCCAAGACTGGCATCAAGGAATGCCAGCACCAGTTCCGGCAGCGGCGGTGGAATT
GC
AGCACAGCGGACAACGCATCTGTCTTTGGGAGAGTCATGCAGATAGGCAGCCGAGAGACCGCCTTCAC
C
CACGCGGTGAGCGCCGCGGGCGTGGTCAACGCCATCAGCCGGGCCTGCCGCGAGGGCGAGCTCTCCACC
TGC
GGCTGCAGCCGGACGGCGCGGCCCAAGGACCTGCCCCGGGACTGGCTGTGGGGCGGCTGTGGGGACA
AC
GTGGAGTACGGCTACCGCTTCGCCAAGGAGTTTGTGGATGCCCGGGAGCGAGAGAAGAACTTTGCCAA
A
GGATCAGAGGAGCAGGGCCGGGTGCTCATGAACCTGCAAAACAACGAGGCCGGTCGCAGGGCTGTGTAT
AAG
ATGGCAGACGTAGCCTGCAAATGCCACGGCGTCTCGGGGTCCTGCAGCCTCAAGACCTGCTGGCTGC
AG
CTGGCCGAGTTCCGCAAGGTCGGGGACCGGCTGAAGGAGAAGTACGACAGCGCGGCCGCCATGCGCGT
C
ACCCGCAAGGGCCGGCTGGAGCTGGTCAACAGCCGCTTCACCCAGCCCACCCCGGAGGACCTGGTCTAT
GTG
GACCCCAGCCCCGACTACTGCCTGCGCAACGAGAGCACGGGCTCCCTGGGCACGCAGGGCCGCCTCT
GC
AACAAGACCTCGGAGGGCATGGATGGCTGTGAGCTCATGTGCTGCGGGCGTGGCTACAACCAGTTCAA
G
AGCGTGCAGGTGGAGCGCTGCCACTGCAAGTTCCACTGGTGCTGCTTCGTCAGGTGTAAGAAGTGCACG
GAG
ATCGTGGACCAGTACATCTGTAAATAG


Translation (359 aa):
MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMA
Y
IGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQI
GSRETAFTHAVSAAGVVNAISRACREGELST
C
GCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRR
AVY
K
MADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVY
V
DPSPDYCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT
E
IVDQYICK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser