NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8500.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8500.1 Public Homo sapiens 11 B3GAT1 22 109 92 CCDS HistoryNCBI Gene:27087Re-query CCDS DB by CCDS ID:8500.1Re-query CCDS DB by GeneID:27087See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8500.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000312527.8 ENSP00000307875.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000312527.8Link to Ensembl Protein Viewer:ENSP00000307875.4Re-query CCDS DB by Nucleotide ID:ENST00000312527Re-query CCDS DB by Protein ID:ENSP00000307875
Original member Current member EBI,WTSI ENST00000392580.5 ENSP00000376359.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392580.5Link to Ensembl Protein Viewer:ENSP00000376359.1Re-query CCDS DB by Nucleotide ID:ENST00000392580Re-query CCDS DB by Protein ID:ENSP00000376359
Original member Current member EBI,WTSI ENST00000524765.1 ENSP00000433847.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000524765.1Link to Ensembl Protein Viewer:ENSP00000433847.1Re-query CCDS DB by Nucleotide ID:ENST00000524765Re-query CCDS DB by Protein ID:ENSP00000433847
Original member Current member NCBI NM_018644.3 NP_061114.2 Accepted alive Link to Nucleotide Sequence:NM_018644.3Link to Protein Sequence:NP_061114.2Re-query CCDS DB by Nucleotide ID:NM_018644Re-query CCDS DB by Protein ID:NP_061114Link to BLAST:NP_061114.2
Original member Current member NCBI NM_054025.2 NP_473366.1 Accepted alive Link to Nucleotide Sequence:NM_054025.2Link to Protein Sequence:NP_473366.1Re-query CCDS DB by Nucleotide ID:NM_054025Re-query CCDS DB by Protein ID:NP_473366Link to BLAST:NP_473366.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_061114.2 334 Q9P2W7-1 334 100% 0 0
NP_473366.1 334 Q9P2W7-1 334 100% 0 0

Chromosomal Locations for CCDS 8500.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 134381938 134382024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 134382710 134383006 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 134383680 134384188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 134387548 134387659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1005 nt):
ATGCCGAAGAGACGGGACATCCTAGCGATCGTCCTCATCGTGCTGCCCTGGACTCTGCTCATCACTGTCT
GG
CACCAGAGCACCCTCGCACCCCTGCTCGCGGTACATAAGGATGAGGGCAGTGACCCCCGACGCGAAAC
G
CCGCCCGGCGCCGACCCCAGGGAGTACTGCACGTCTGACCGCGACATCGTGGAGGTGGTGCGCACCGAG
TAC
GTGTACACGCGGCCCCCGCCATGGTCCGACACGCTGCCCACCATCCACGTGGTGACGCCCACCTACA
GC
CGCCCGGTGCAGAAGGCCGAGCTGACGCGCATGGCCAACACGCTGCTGCACGTGCCCAACCTCCACTG
G
CTGGTGGTGGAGGATGCGCCGCGCCGGACGCCGCTGACCGCGCGCCTGCTGCGCGACACCGGCCTCAAC
TAC
ACGCACCTGCACGTGGAGACGCCCCGCAACTACAAGCTGCGCGGAGACGCCCGCGACCCACGCATCC
CG
CGGGGCACCATGCAGCGCAACCTGGCCCTGCGCTGGCTGCGCGAGACCTTCCCGCGCAACTCCAGCCA
G
CCTGGCGTGGTCTACTTCGCCGACGACGACAACACCTACAGCCTGGAGCTCTTCGAAGAGATGCGCAGC
ACC
AGGAGGGTGTCCGTGTGGCCCGTCGCCTTCGTGGGTGGCCTGCGGTACGAGGCCCCACGGGTGAACG
GG
GCAGGGAAGGTGGTCGGCTGGAAGACGGTGTTTGACCCCCACCGGCCATTTGCAATAGACATGGCTGG
A
TTTGCCGTCAACCTGCGGCTCATTCTGCAGCGAAGCCAGGCCTACTTCAAGCTGCGAGGTGTGAAGGGA
GGC
TACCAGGAAAGCAGCCTCCTTCGAGAACTTGTCACCCTCAACGACCTGGAGCCCAAGGCAGCCAACT
GC
ACCAAGATCCTGGTGTGGCACACACGGACAGAGAAGCCAGTGCTGGTGAATGAGGGCAAGAAGGGCTT
C
ACTGACCCCTCGGTGGAGATCTGA


Translation (334 aa):
MPKRRDILAIVLIVLPWTLLITVWHQSTLAPLLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTE
Y
VYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVVEDAPRRTPLTARLLRDTGLN
Y
THLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRNSSQPGVVYFADDDNTYSLELFEE
MRS
T
RRVSVWPVAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKG
G
YQESSLLRELVTLNDLEPKAANCTK
ILVWHTRTEKPVLVNEGKKGFTDPSVEI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser