NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS82958.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
82958.1 Public Homo sapiens 4 INPP4B 22 109 92 CCDS HistoryNCBI Gene:8821Re-query CCDS DB by CCDS ID:82958.1Re-query CCDS DB by GeneID:8821See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 20, NCBI annotation release 108, Ensembl annotation release 85

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 82958.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000509777.5 ENSP00000422793.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000509777.5Link to Ensembl Protein Viewer:ENSP00000422793.1Re-query CCDS DB by Nucleotide ID:ENST00000509777Re-query CCDS DB by Protein ID:ENSP00000422793
Original member Current member NCBI NM_001331040.1 NP_001317969.1 Accepted alive Link to Nucleotide Sequence:NM_001331040.1Link to Protein Sequence:NP_001317969.1Re-query CCDS DB by Nucleotide ID:NM_001331040Re-query CCDS DB by Protein ID:NP_001317969Link to BLAST:NP_001317969.1

Chromosomal Locations for CCDS 82958.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 142030128 142030302 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142082031 142082185 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142086144 142086256 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142108093 142108190 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142112542 142112682 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142122128 142122245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142123292 142123415 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142124588 142124760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142145840 142145996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142160358 142160561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142173632 142173809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142193087 142193195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142208425 142208529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142208896 142209026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142237864 142238011 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142260492 142260564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142270663 142270774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142305458 142305537 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142314712 142314762 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142402938 142403054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142405206 142405324 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142429173 142429217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 142431169 142431259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2817 nt):
ATGGAAATTAAAGAGGAAGGGGCATCAGAAGAAGGGCAGCACTTTCTTCCTACAGCCCAGGCCAATGATC
CC
GGGGACTGTCAGTTCACAAGTATCCAGAAGACTCCAAATGAACCGCAGTTGGAATTCATCCTTGCATG
C
AAGGATCTCGTGGCTCCTGTCCGTGATCGTAAACTGAATACACTGGTGCAGATCTCCGTAATCCACCCC
GTG
GAGCAGAGTCTGACAAGATACTCCAGCACCGAAATTGTGGAGGGAACAAGGGACCCACTGTTTTTGA
CT
GGTGTCACATTCCCATCTGAGTATCCCATCTATGAGGAGACCAAAATAAAACTAACAGTCTATGATGT
C
AAGGATAAGTCTCATGACACCGTTCGAACCAGTGTCCTACCAGAACATAAGGATCCCCCGCCAGAAGTT
GGG
CGAAGTTTCTTGGGCTATGCCAGTTTTAAAGTGGGAGAGCTGCTGAAGTCAAAGGAGCAATTGCTGG
TC
CTGAGCCTGAGAACTTCAGATGGTGGCAAAGTGGTTGGCACCATAGAAGTCAGTGTCGTGAAGATGGG
G
GAGATTGAGGATGGGGAAGCCGACCACATCACCACAGATGTACAGGGACAAAAGTGTGCCCTGGTATGT
GAA
TGTACAGCCCCGGAAAGTGTGAGCGGAAAAGATAACTTACCTTTTTTGAATTCAGTGTTAAAGAACC
CA
GTATGTAAATTATATAGATTTCCCACATCTGACAATAAGTGGATGCGAATTCGAGAGCAGATGTCAGA
G
AGCATTCTTTCCTTTCATATTCCTAAGGAATTGATTTCCCTTCACATTAAAGAAGATTTGTGCAGAAAC
CAG
GAGATAAAAGAACTTGGTGAGCTTTCTCCACATTGGGACAATCTGCGAAAAAATGTCCTTACTCACT
GT
GATCAAATGGTGAATATGTACCAAGACATTCTGACAGAACTTAGCAAGGAAACAGGGTCCTCTTTCAA
A
TCAAGCAGCAGCAAAGGAGAGAAAACATTAGAATTTGTTCCAATAAATCTACATCTGCAAAGAATGCAG
GTA
CACAGCCCTCACTTGAAAGATGCTCTCTACGATGTCATCACTGTGGGAGCCCCAGCTGCCCATTTTC
AG
GGATTTAAGAATGGTGGTCTTCGGAAGCTACTCCATAGATTTGAAACAGAAAGAAGAAATACCGGATA
C
CAGTTTATTTACTATTCACCTGAAAACACAGCCAAAGCAAAGGAAGTTCTCAGCAACATCAATCAACTA
CAA
CCTCTTATAGCAACCCATGCAGACCTACTGCTTAATTCTGCAAGCCAGCATTCTCCAGACAGCTTGA
AG
AATTCTTTAAAGATGCTTTCAGAAAAAACAGAGCTTTTTGTACATGCCTTCAAGGATCAACTTGTCAG
G
AGTGCTCTTTTAGCACTCTACACTGCAAGGCCAGGAGGCATTCTTAAGAAGCCACCCTCTCCTAAGAGC
AGC
ACAGAGGAGAGCAGTCCCCAAGACCAACCCCCAGTGATGAGAGGGCAGGACTCCATACCACATCATT
CA
GACTATGATGAGGAAGAGTGGGACAGGGTGTGGGCCAATGTGGGGAAGAGCCTGAACTGCATTATTGC
T
ATGGTGGACAAACTGATTGAAAGAGATGGTGGCAGTGAAGGCAGTGGCGGCAACAATGATGGAGAAAAG
GAA
CCTTCATTAACAGATGCCATTCCCTCTCACCCAAGAGAGGACTGGTATGAACAGTTGTATCCCCTCA
TC
CTTACCCTGAAGGACTGCATGGGAGAAGTGGTGAACCGAGCCAAGCAGTCCCTGACATTTGTGCTCCT
T
CAGGAACTTGCGTACAGCTTGCCCCAGTGTCTGATGCTGACGCTAAGAAGAGACATCGTCTTCAGCCAA
GCA
CTTGCTGGATTGGTTTGTGGTTTTATCATCAAATTACAGACAAGTCTGTATGACCCAGGCTTCCTAC
AG
CAGCTTCACACAGTGGGGTTGATAGTACAATATGAAGGACTGCTAAGTACATACAGCGATGAAATTGG
A
ATGCTAGAGGACATGGCCGTTGGCATTTCCGATTTAAAGAAAGTTGCATTTAAAATAATTGAAGCCAAA
TCC
AATGATGTGTTGCCAGTTATAACAGGAAGACGAGAACATTACGTGGTAGAGGTCAAGCTTCCAGCCA
GA
ATGTTTGAGTCACTACCTCTACAGATTAAAGAAGGACAGTTGCTTCATGTGTATCCAGTACTTTTTAA
T
GTTGGAATCAATGAACAGCAAACTCTGGCTGAAAGGTTTGGAGATGTCTCTTTGCAAGAAAGTATTAAT
CAG
GAAAACTTCGAACTTCTACAAGAATATTACAAGATATTTATGGAAAAGATGCCTCCTGATTATATTT
CA
CATTTTCAGGAACAAAATGATTTAAAAGCATTGCTAGAAAATCTCCTTCAAAATATCCAATCCAAAAA
A
AGAAAGAATGTAGAAATTATGTGGCTGGCTGCAACGATTTGCCGCAAACTGAATGGTATTCGTTTCACC
TGT
TGTAAAAGTGCCAAAGACAGGACATCGATGTCAGTGACACTTGAACAATGCTCAATCTTGAGAGATG
AG
CACCAGTTACACAAGGACTTCTTTATCCGAGCGCTGGATTGCATGAGAAGCAGACAAACCCAGGGAGC
A
CTGAATGAATCCGATGATCCTGAAACAGGCTGTCTAACTGATAACAAGCCAACTTCTCGACACTTCTAT
CCT
GTCGCCTTGCTGCTTGTCAGCTCACACCTGCTAGTTGTGTGGCTTATTTTAAGTCTGGCGTTACTCT
TA
GCCAAATACCAATAA


Translation (938 aa):
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHP
V
EQSLTRYSSTEIVE
GTRDPLFLTGVTFPSEYPIYEETKIKLTVYDVKDKSHDTVRTSVLPEHKDPPPEV
G
RSFLGYASFKVGELLKSKEQLLVLSLRTSDGGKVVGTIEVSVVKMGEIEDGEADHITTDVQGQKCALVC
E
CTAPESVSGKDNLPFLNS
VLKNPVCKLYRFPTSDNKWMRIREQMSESILSFHIPKELISLHIKEDLCRN
Q
EIKELGELSPHWDNLRKNVLTHCDQMVNMYQDILTELSKET
GSSFKSSSSKGEKTLEFVPINLHLQRMQ
V
HSPHLK
DALYDVITVGAPAAHFQGFKNGGLRKLLHRFETERRNTGYQFIYYSPENTAKAKEVLSNINQL
Q
PLIATHADLLLNSASQHSPDSLKNSLKMLSEK
TELFVHAFKDQLVRSALLALYTARPGGILKKPPSPKS
S
TEESSPQDQPPVMRGQDSIPHHSDYDEEEW
DRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEK
E
PSLTDAIPSHPR
EDWYEQLYPLILTLKDCMGEVVNRAKQSLTFVLLQELAYSLPQCLMLTLRRDIVFSQ
A
LAGLVCGFIIKLQTSLYDPGFLQQLHTVGLIVQYEGLLSTYSDEIGMLEDMAVGISDLKKVAFKIIEAK
S
NDVLPVITGR
REHYVVEVKLPARMFESLPLQIKEGQLLHVYPVLFNVGINEQQTLAERFGDVSLQESIN
Q
ENFELLQEYYKIFMEKMPPD
YISHFQEQNDLKALLENLLQNIQSKKRKNVEIMWLAATICRKLNGIRFT
C
CKSAKDRTSMSVTLEQCSILRDEHQLHKDFFIRALDCMR
SRQTQGALNESDDPETGCLTDNKPTSRHFY
P
VALLLVSSHLLVVWLILSLALLLAKYQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser