NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS82417.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
82417.1 Public Homo sapiens 2 CPSF3 24 110 108 CCDS HistoryNCBI Gene:51692Re-query CCDS DB by CCDS ID:82417.1Re-query CCDS DB by GeneID:51692See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 20, NCBI annotation release 108, Ensembl annotation release 85

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 82417.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000460593.1 ENSP00000418957.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000460593.1Link to Ensembl Protein Viewer:ENSP00000418957.1Re-query CCDS DB by Nucleotide ID:ENST00000460593Re-query CCDS DB by Protein ID:ENSP00000418957
Original member Current member NCBI NM_001321833.2 NP_001308762.1 Accepted alive Link to Nucleotide Sequence:NM_001321833.2Link to Protein Sequence:NP_001308762.1Re-query CCDS DB by Nucleotide ID:NM_001321833Re-query CCDS DB by Protein ID:NP_001308762Link to BLAST:NP_001308762.1
Original member Current member NCBI NM_001321834.2 NP_001308763.1 Accepted alive Link to Nucleotide Sequence:NM_001321834.2Link to Protein Sequence:NP_001308763.1Re-query CCDS DB by Nucleotide ID:NM_001321834Re-query CCDS DB by Protein ID:NP_001308763Link to BLAST:NP_001308763.1

Chromosomal Locations for CCDS 82417.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 9428826 9428828 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9429923 9430020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9430752 9430880 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9432511 9432688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9433871 9433960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9436211 9436361 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9440491 9440666 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9441818 9441976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9443515 9443661 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9448198 9448350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9452913 9453021 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9455659 9455757 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9456933 9457027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9459531 9459618 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9467707 9467776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9471343 9471439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 9472916 9473017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1944 nt):
ATGCTCGACTGTGGGATCCACCCTGGCCTAGAAGGAATGGATGCTCTTCCTTATATTGATTTAATTGACC
CA
GCTGAGATTGATCTCCTATTAATTAGTCATTTCCATTTGGATCACTGTGGAGCTCTGCCCTGGTTTCT
A
CAGAAGACAAGTTTCAAAGGAAGAACATTTATGACTCATGCCACAAAAGCTATTTATAGATGGCTTCTT
TCT
GATTATGTCAAAGTTAGTAACATATCAGCAGACGACATGCTGTATACCGAGACAGATTTGGAAGAAA
GC
ATGGACAAAATTGAAACTATCAACTTTCATGAAGTTAAGGAAGTTGCGGGAATCAAGTTTTGGTGTTA
C
CATGCAGGTCACGTCCTAGGAGCCGCCATGTTCATGATTGAGATCGCAGGCGTGAAGCTTTTGTACACT
GGT
GATTTCTCAAGACAAGAAGATAGGCACTTAATGGCAGCTGAAATTCCTAATATTAAGCCTGATATTC
TT
ATCATTGAATCTACTTATGGGACCCATATCCATGAGAAACGTGAAGAGCGAGAAGCAAGATTCTGTAA
C
ACTGTCCACGATATTGTAAACAGAGGAGGCAGGGGTCTCATTCCTGTCTTTGCTCTTGGAAGGGCTCAG
GAG
CTGCTCTTGATTCTAGATGAGTACTGGCAGAATCACCCAGAACTACATGACATTCCAATATACTATG
CA
TCATCTTTGGCCAAGAAGTGTATGGCAGTGTACCAGACATATGTAAATGCCATGAATGACAAAATCCG
C
AAACAGATCAACATCAATAATCCCTTTGTTTTCAAACACATTAGTAACCTCAAGAGCATGGATCATTTT
GAT
GACATTGGTCCCAGTGTTGTAATGGCCTCCCCAGGCATGATGCAAAGTGGCTTATCCAGAGAATTAT
TT
GAAAGCTGGTGTACTGATAAGAGGAATGGTGTCATTATAGCGGGATACTGTGTAGAAGGGACACTTGC
C
AAGCACATCATGTCTGAACCTGAAGAAATCACTACTATGTCTGGACAGAAGTTACCACTGAAAATGTCT
GTT
GATTACATTTCTTTCTCAGCTCACACGGATTACCAGCAAACCAGTGAATTTATTCGTGCTTTGAAAC
CG
CCTCATGTGATTTTAGTCCATGGAGAACAGAATGAAATGGCCAGATTGAAAGCAGCACTGATTCGAGA
A
TATGAAGATAACGATGAAGTTCACATAGAGGTTCATAATCCTCGGAATACAGAAGCAGTGACCTTAAAC
TTC
AGAGGAGAAAAACTAGCCAAGGTTATGGGATTTTTAGCAGACAAAAAACCAGAACAAGGCCAGCGGG
TC
TCAGGAATACTTGTTAAAAGAAACTTTAATTATCACATACTTTCTCCTTGCGACCTGTCCAATTATAC
T
GACCTGGCCATGAGCACGGTGAAGCAGACCCAAGCCATTCCATATACTGGTCCCTTTAATTTGCTCTGT
TAC
CAGCTGCAGAAATTGACAGGTGATGTGGAAGAATTAGAAATTCAAGAAAAACCTGCTCTGAAAGTGT
TC
AAAAATATTACTGTAATACAAGAACCAGGCATGGTGGTATTAGAATGGCTGGCAAACCCTTCTAATGA
T
ATGTATGCAGATACAGTAACAACTGTGATATTGGAAGTTCAGTCAAATCCCAAAATAAGAAAAGGTGCA
GTA
CAGAAGGTTTCTAAAAAATTAGAAATGCACGTTTACAGCAAGAGGTTGGAGATCATGCTCCAGGACA
TA
TTTGGAGAAGACTGTGTAAGTGTAAAGGATGACTCTATTCTTAGCGTCACAGTGGACGGGAAAACTGC
C
AACCTTAACTTGGAGACACGGACTGTAGAATGTGAAGAGGGAAGTGAAGACGATGAATCCCTCCGAGAA
ATG
GTGGAGCTGGCTGCACAGAGACTGTACGAGGCCCTGACGCCAGTTCACTGA


Translation (647 aa):
MLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLL
S
DYVKV
SNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYT
G
DFSRQEDRHLMAAEIPNIKPDILII
ESTYGTHIHEKREEREARFCNTVHDIVNRGGRGLIPVFALGRAQ
E
LLLIL
DEYWQNHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIRKQININNPFVFKHISNLKSMDHF
D
DIGPSVVMASPGMMQSGLSRELFESWCTDKRNGVIIAGYCVEGTLAK
HIMSEPEEITTMSGQKLPLKMS
V
DYISFSAHTDYQQTSEFIRALKPPHV
ILVHGEQNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLN
F
RGEKLAK
VMGFLADKKPEQGQRVSGILVKRNFNYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLC
Y
QLQKLT
GDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGA
V
QKVSKKLEMHVYSKRLEIML
QDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLRE
M
VELAAQRLYEALTPVH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser