NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8213.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8213.1 Public Homo sapiens 11 INPPL1 22 109 92 CCDS HistoryNCBI Gene:3636Re-query CCDS DB by CCDS ID:8213.1Re-query CCDS DB by GeneID:3636See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8213.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000298229.6 ENSP00000298229.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000298229.6Link to Ensembl Protein Viewer:ENSP00000298229.2Re-query CCDS DB by Nucleotide ID:ENST00000298229Re-query CCDS DB by Protein ID:ENSP00000298229
Original member NCBI NM_001567.3 NP_001558.3 Updated not alive Link to Nucleotide Sequence:NM_001567.3Link to Protein Sequence:NP_001558.3Re-query CCDS DB by Nucleotide ID:NM_001567Re-query CCDS DB by Protein ID:NP_001558
Current member NCBI NM_001567.4 NP_001558.3 Accepted alive Link to Nucleotide Sequence:NM_001567.4Link to Protein Sequence:NP_001558.3Re-query CCDS DB by Nucleotide ID:NM_001567Re-query CCDS DB by Protein ID:NP_001558Link to BLAST:NP_001558.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001558.3 1258 O15357-1 1258 100% 0 0

Chromosomal Locations for CCDS 8213.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 72224985 72225166 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72228190 72228253 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72228348 72228498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72228727 72228847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72229090 72229230 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72229465 72229558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72229663 72229752 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72229924 72230019 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72230121 72230271 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72230362 72230468 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72230796 72230898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72230993 72231189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72231498 72231615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72232240 72232336 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72232626 72232764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72232875 72232974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72233075 72233163 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72233441 72233522 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72233655 72233744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72234281 72234394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72234527 72234615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72235116 72235203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72235296 72235451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72235675 72235753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72235846 72235986 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72237124 72237796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72238042 72238175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72238263 72238353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3777 nt):
ATGGCCTCGGCCTGCGGGGCGCCGGGCCCGGGGGGCGCCCTGGGCAGCCAGGCCCCCTCCTGGTACCACC
GC
GACCTGAGCCGGGCGGCCGCGGAGGAGCTGCTGGCCCGGGCGGGCCGCGATGGCAGCTTCCTGGTCCG
A
GACAGCGAGAGCGTGGCGGGGGCCTTCGCGCTCTGCGTCCTGTATCAGAAGCATGTGCACACGTATCGC
ATT
CTGCCTGATGGAGAAGATTTCTTGGCTGTGCAGACCTCGCAGGGTGTGCCTGTGCGCCGCTTCCAGA
CC
CTGGGTGAGCTCATCGGCCTGTACGCCCAGCCCAACCAGGGCCTTGTGTGCGCCCTGCTTCTTCCTGT
A
GAGGGTGAGCGAGAGCCGGACCCACCGGATGACCGGGATGCCTCAGATGGGGAGGATGAGAAGCCCCCG
CTG
CCCCCGCGCTCTGGCTCCACCAGCATTTCTGCCCCCACTGGGCCCAGCAGTCCCCTGCCAGCTCCTG
AG
ACTCCCACAGCTCCAGCTGCTGAGAGTGCTCCCAATGGGCTGAGCACCGTCTCGCACGACTACCTGAA
A
GGCAGCTATGGGCTGGACCTGGAAGCTGTGAGGGGTGGAGCCAGCCACCTGCCCCACCTCACCCGTACC
CTC
GCTACCTCATGCCGGAGGCTGCACAGTGAGGTGGACAAGGTCCTGTCAGGCCTGGAGATCCTGTCCA
AG
GTGTTTGACCAGCAGAGCTCGCCCATGGTGACCCGCCTTTTGCAGCAGCAGAACCTGCCACAGACAGG
G
GAGCAGGAACTAGAGAGCCTGGTGCTGAAGCTGTCAGTGCTAAAGGACTTCCTGTCAGGCATCCAGAAG
AAG
GCCCTGAAGGCCCTACAGGACATGAGCTCCACAGCACCCCCAGCTCCGCAGCCATCCACACGTAAGG
CC
AAGACCATCCCCGTGCAGGCCTTTGAGGTGAAGCTAGATGTGACCCTGGGTGACCTGACCAAGATTGG
G
AAGTCACAGAAGTTCACGCTGAGCGTGGATGTGGAGGGTGGGCGGCTGGTGCTGCTGCGGAGACAGCGG
GAC
TCCCAGGAGGACTGGACCACCTTCACGCACGACCGCATCCGCCAGCTCATTAAGTCCCAGCGTGTCC
AG
AACAAGCTGGGTGTTGTGTTTGAGAAGGAGAAGGACCGGACTCAGCGCAAGGACTTCATCTTTGTCAG
T
GCCCGGAAGCGGGAGGCCTTCTGCCAGCTGTTGCAGCTCATGAAGAACAAGCACTCCAAGCAGGACGAG
CCC
GACATGATCTCAGTCTTCATAGGCACCTGGAACATGGGAAGTGTACCACCTCCAAAAAACGTGACAT
CC
TGGTTCACATCGAAGGGTCTGGGGAAGACCCTGGACGAGGTCACAGTGACCATACCCCATGACATCTA
T
GTCTTTGGGACCCAGGAGAACTCAGTGGGCGACCGCGAGTGGCTGGACCTACTGCGCGGGGGCCTCAAG
GAG
CTTACGGATCTGGATTACCGCCCGATTGCCATGCAATCACTGTGGAATATCAAGGTGGCAGTGCTGG
TC
AAGCCAGAGCACGAGAACCGTATCAGCCATGTCAGTACGTCCAGTGTGAAGACTGGCATCGCCAACAC
C
CTGGGGAACAAGGGGGCTGTGGGCGTCTCCTTCATGTTTAATGGCACCTCATTTGGCTTTGTGAATTGT
CAC
CTCACCTCGGGAAATGAGAAGACGGCTCGGAGGAACCAAAACTACTTGGACATCCTGCGGCTGCTCT
CG
CTGGGCGACCGGCAGCTCAATGCCTTTGACATCTCTCTGCGTTTCACACACCTCTTCTGGTTTGGGGA
C
CTCAACTACCGCCTGGACATGGATATCCAGGAGATCCTGAACTACATCAGCAGGAAAGAGTTTGAGCCC
CTC
CTCAGGGTGGACCAGCTCAACCTGGAGCGGGAGAAGCACAAGGTCTTCCTTCGATTCAGTGAGGAGG
AG
ATCTCCTTCCCACCCACCTACCGCTATGAGCGGGGTTCCCGGGACACATATGCCTGGCACAAGCAGAA
G
CCAACTGGGGTCCGGACCAATGTGCCCTCATGGTGTGACCGGATTCTGTGGAAATCCTACCCTGAAACT
CAC
ATCATCTGCAATTCTTATGGTTGCACTGATGACATCGTCACCAGCGACCATTCCCCCGTGTTTGGGA
CA
TTTGAGGTTGGAGTTACCTCCCAGTTCATCTCCAAGAAAGGGCTCTCAAAGACTTCAGACCAGGCCTA
C
ATTGAGTTTGAGAGCATCGAGGCCATTGTGAAGACAGCCAGCCGCACCAAGTTCTTCATCGAGTTCTAC
TCT
ACCTGCCTGGAGGAATACAAGAAGAGCTTTGAGAATGATGCCCAGAGCAGTGACAACATCAACTTCC
TC
AAAGTGCAGTGGTCTTCACGCCAGCTGCCCACGCTCAAACCAATTCTGGCTGATATCGAGTACCTGCA
G
GACCAGCACCTCCTGCTCACAGTCAAGTCCATGGATGGCTATGAATCCTATGGGGAGTGTGTGGTTGCA
CTC
AAATCCATGATCGGCAGCACGGCCCAACAGTTCCTGACCTTCCTATCCCACCGTGGCGAGGAGACAG
GC
AATATCAGAGGCTCCATGAAGGTGCGGGTGCCCACGGAGCGCCTGGGCACCCGTGAGCGGCTCTACGA
G
TGGATCAGCATTGATAAGGATGAGGCAGGAGCAAAGAGCAAAGCCCCCTCTGTGTCCCGAGGGAGCCAG
GAG
CCCAGGTCAGGGAGCCGCAAGCCAGCCTTCACAGAGGCCTCCTGCCCGCTCTCCAGGTTATTTGAAG
AA
CCAGAGAAACCGCCACCAACGGGGAGGCCCCCAGCCCCACCCCGAGCAGCTCCCCGGGAGGAGCCCTT
G
ACCCCCAGGTTGAAGCCAGAGGGAGCTCCTGAACCAGAAGGGGTGGCGGCCCCCCCACCCAAGAACAGC
TTC
AATAACCCTGCCTACTACGTCCTTGAAGGGGTCCCGCACCAGCTGCTGCCCCCGGAGCCACCCTCGC
CT
GCCAGGGCCCCTGTCCCATCTGCCACCAAGAACAAAGTGGCCATTACAGTGCCTGCTCCACAGCTTGG
G
CACCACCGGCACCCTCGTGTGGGAGAGGGGAGTTCTTCAGATGAGGAGTCTGGAGGCACACTGCCCCCT
CCA
GACTTTCCACCTCCACCACTGCCGGACTCAGCCATCTTCCTGCCCCCCAGCCTGGATCCTTTACCAG
GG
CCAGTGGTCCGGGGCCGTGGTGGGGCTGAGGCCCGTGGCCCACCACCTCCCAAGGCCCATCCAAGGCC
T
CCACTGCCCCCAGGCCCCTCACCAGCCAGCACTTTCCTGGGGGAAGTGGCCAGTGGGGATGACCGGTCC
TGC
TCGGTGCTGCAGATGGCCAAGACGCTGAGCGAGGTGGACTATGCCCCTGCTGGGCCTGCACGCTCAG
CG
CTCCTCCCAGGCCCCCTGGAGCTGCAGCCCCCCCGGGGACTGCCCTCGGACTATGGCCGGCCCCTCAG
C
TTCCCTCCACCCCGCATCCGGGAGAGCATCCAGGAAGACCTGGCAGAGGAGGCTCCGTGCCTGCAGGGC
GGG
CGGGCCAGCGGGCTGGGCGAGGCAGGCATGAGTGCCTGGCTGCGGGCCATCGGCTTGGAGCGCTATG
AG
GAGGGCCTGGTGCATAATGGCTGGGACGACCTGGAGTTTCTCAGTGACATCACCGAGGAGGACTTGGA
G
GAGGCTGGGGTGCAGGACCCGGCTCACAAGCGCCTCCTTCTGGACACCCTGCAGCTCAGCAAGTGA


Translation (1258 aa):
MASACGAPGPGGALGSQAPSWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGAFALCVLYQKHVHTYR
I
LPDGEDFLAVQ
TSQGVPVRRFQTLGELIGLYAQPNQGLVCALLLPVEGEREPDPPDDRDASDGEDEKPP
L
PPRSGSTSISAPTGPSSPLPAPETPTAPAAE
SAPNGLSTVSHDYLKGSYGLDLEAVRGGASHLPHLTRT
L
ATSCRRLH
SEVDKVLSGLEILSKVFDQQSSPMVTRLLQQQNLPQTGEQELESLVLKLSVLKDFLSGIQK
K
ALKALQDMSSTAPPAPQPSTRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQR
D
SQEDWTTFTHDR
IRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNKHSKQDE
P
DMISVFIGTWNM
GSVPPPKNVTSWFTSKGLGKTLDEVTVTIPHDIYVFGTQENSVGDREWLDLLRGGLK
E
LTDLDYRP
IAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGIANTLGNKGAVGVSFMFNGTSFGFVNC
H
LTSGNEKTA
RRNQNYLDILRLLSLGDRQLNAFDISLRFTHLFWFGDLNYRLDMDIQEILNYISRKEFEP
L
LRVDQLNLEREKHKVFLRF
SEEEISFPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPET
H
IICNSY
GCTDDIVTSDHSPVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFY
S
TCLE
EYKKSFENDAQSSDNINFLKVQWSSRQLPTLKPILADIEYLQDQHLLLTVKSMDGYESYGECVVA
L
KSMIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLY
EWISIDKDEAGAKSKAPSVSRGSQ
E
P
RSGSRKPAFTEASCPLSRLFEEPEKPPPTGRPPAPPRAAPREEPLTPRLKPEGAPEPEGVAAPPPKNS
F
NNPAYYVLEGVPHQLLPPEPPSPARAPVPSATKNKVAITVPAPQLGHHRHPRVGEGSSSDEESGGTLPP
P
DFPPPPLPDSAIFLPPSLDPLPGPVVRGRGGAEARGPPPPKAHPRPPLPPGPSPASTFLGEVASGDDRS
C
SVLQMAKTLSEVDYAPAGPARSALLPGPLELQPPRGLPSDYGRPLSFPPPRIRESIQEDLAEE
APCLQG
G
RASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFL
SDITEEDLEEAGVQDPAHKRLLLDTLQLSK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser