NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, May 21, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS82031.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
82031.1 Public Homo sapiens 17 TLCD3A 24 110 108 CCDS HistoryNCBI Gene:79850Re-query CCDS DB by CCDS ID:82031.1Re-query CCDS DB by GeneID:79850See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 20, NCBI annotation release 108, Ensembl annotation release 85

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 82031.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000301324.8 ENSP00000301324.8 Accepted alive Link to Ensembl Transcript Viewer:ENST00000301324.8Link to Ensembl Protein Viewer:ENSP00000301324.8Re-query CCDS DB by Nucleotide ID:ENST00000301324Re-query CCDS DB by Protein ID:ENSP00000301324
Original member Current member NCBI NM_001318006.2 NP_001304935.1 Accepted alive Link to Nucleotide Sequence:NM_001318006.2Link to Protein Sequence:NP_001304935.1Re-query CCDS DB by Nucleotide ID:NM_001318006Re-query CCDS DB by Protein ID:NP_001304935Link to BLAST:NP_001304935.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001304935.1 225 Q8TBR7-1 225 100% 0 0

Chromosomal Locations for CCDS 82031.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 732648 732769 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 733098 733181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 737846 738047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 741301 741570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (678 nt):
ATGCTGCTGACGCTGGCCGGGGGCGCGCTCTTCTTCCCGGGGCTCTTCGCGCTCTGCACCTGGGCGCTGC
GC
CGCTCCCAGCCCGGATGGAGCCGCACCGACTGCGTGATGATCAGCACCAGGCTGGTTTCCTCGGTGCA
C
GCCGTGCTGGCCACCGGCTCGGGGATCGTCATCATTCGCTCCTGCGACGACGTGATCACCGGCAGGCAC
TGG
CTTGCCCGGGAATATGTGTGGTTTCTGATTCCATACATGATCTATGACTCGTACGCCATGTACCTCT
GT
GAATGGTGCCGAACCAGAGACCAGAACCGTGCGCCCTCCCTCACTCTTCGAAACTTCCTAAGTCGAAA
C
CGCCTCATGATCACACATCATGCGGTCATTCTCTTTGTCCTTGTGCCAGTCGCACAGCTAAAGCAGCAG
CAC
ACCCTTCTGTACAAGGTGAATGGAATCCTCACGCTGGCCACCTTCCTTTCCTGCCGGATCCTTCTCT
TC
CCCTTCATGTACTGGTCCTATGGCCGCCAGCAGGGACTAAGCCTGCTCCAAGTACCCTTCAGCATCCC
A
TTCTACTGCAACGTGGCCAATGCCTTCCTCGTAGCTCCTCAGATCTACTGGTTCTGTCTGCTGTGCAGG
AAG
GCAGTCCGGCTCTTTGACACTCCCCAAGCCAAAAAGGATGGCTAA


Translation (225 aa):
MLLTLAGGALFFPGLFALCTWALRRSQPGWSRTDCVMISTRLVSSVHAVLATGSGIVIIRSCDDVITGRH
W
LAREYVWFLIPYMIYDSYAMYLCEWCRTRDQNRAPSLTLRNFLSRNRLMITHHAVILFVLVPVAQ
LKQQ
H
TLLYKVNGILTLATFLSCRILLFPFMYWSYGRQQGLSLLQVPFSIPFYCNVANAFLVAPQIYWFCLLCR
K
AVRLFDTPQAKKDG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser