NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS8201.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8201.1 Public Homo sapiens 11 NADSYN1 24 110 108 CCDS HistoryNCBI Gene:55191Re-query CCDS DB by CCDS ID:8201.1Re-query CCDS DB by GeneID:55191See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8201.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000319023.7 ENSP00000326424.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000319023.7Link to Ensembl Protein Viewer:ENSP00000326424.2Re-query CCDS DB by Nucleotide ID:ENST00000319023Re-query CCDS DB by Protein ID:ENSP00000326424
Original member Current member NCBI NM_018161.5 NP_060631.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_018161.5Link to Protein Sequence:NP_060631.2Re-query CCDS DB by Nucleotide ID:NM_018161Re-query CCDS DB by Protein ID:NP_060631Link to BLAST:NP_060631.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_060631.2 706 Q6IA69-1 706 100% 0 0

Chromosomal Locations for CCDS 8201.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 71453297 71453381 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71455110 71455170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71458428 71458544 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71463432 71463485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71464053 71464142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71472449 71472500 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71473278 71473366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71473569 71473686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71474395 71474526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71478395 71478469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71480755 71480879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71481356 71481404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71481923 71482025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71482849 71483017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71484312 71484447 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71485542 71485648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71490845 71490976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71491834 71491903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71497483 71497611 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71498352 71498528 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 71501302 71501352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2121 nt):
ATGGGCCGGAAGGTGACCGTGGCCACCTGCGCACTCAACCAGTGGGCCCTGGACTTCGAGGGCAATTTGC
AA
AGAATTTTAAAGAGTATTGAAATTGCCAAAAACAGAGGAGCAAGATACAGGCTTGGACCAGAGCTGGA
A
ATATGCGGCTACGGATGTTGGGATCATTATTACGAGTCGGACACCCTCTTGCACTCGTTTCAAGTCCTA
GCG
GCCCTTGTGGAGTCTCCCGTCACTCAGGACATCATCTGCGACGTGGGGATGCCTGTAATGCACCGAA
AC
GTCCGCTACAACTGCAGAGTGATATTCCTCAACAGGAAGATCCTGCTCATCAGACCCAAGATGGCCTT
G
GCCAATGAAGGCAACTACCGCGAGCTGCGCTGGTTCACCCCGTGGTCGAGGAGTCGGCACACAGAGGAG
TAC
TTTCTGCCTCGGATGATACAGGACCTGACAAAGCAGGAAACCGTACCCTTCGGAGATGCGGTGCTGG
TG
ACATGGGACACCTGCATTGGAAGTGAGATCTGTGAGGAGCTCTGGACACCCCACAGCCCGCACATCGA
C
ATGGGCCTGGATGGCGTGGAGATCATCACCAACGCCTCGGGCAGCCACCAAGTGCTGCGCAAAGCCAAC
ACC
AGGGTGGATCTCGTGACTATGGTCACCAGCAAGAACGGTGGGATTTACTTGCTGGCCAACCAGAAGG
GT
TGTGACGGGGACCGCCTGTACTACGACGGCTGTGCCATGATTGCCATGAACGGAAGCGTCTTTGCTCA
A
GGATCCCAGTTTTCTCTGGATGACGTGGAAGTCCTGACGGCCACGCTGGATCTGGAGGACGTCCGGAGC
TAC
AGGGCGGAGATTTCATCTCGAAACCTGGCGGCCAGCAGGGCGAGCCCCTACCCCAGAGTGAAGGTGG
AC
TTTGCCCTCTCGTGCCACGAGGACTTGCTGGCACCCATCTCTGAGCCCATCGAGTGGAAATACCACAG
C
CCTGAGGAGGAGATAAGCCTTGGACCTGCCTGCTGGCTCTGGGATTTTTTAAGACGAAGTCAACAGGCA
GGG
TTTTTGCTGCCCTTGAGTGGCGGGGTGGACAGCGCAGCCACCGCCTGCCTCATCTACTCCATGTGCT
GC
CAGGTCTGCGAGGCCGTGAGGAGTGGAAATGAGGAAGTGCTGGCTGATGTCCGCACCATCGTGAACCA
G
ATCAGCTACACCCCCCAGGATCCCCGAGACCTCTGTGGACGCATACTGACCACCTGCTACATGGCCAGC
AAG
AACTCCTCCCAGGAGACGTGCACCCGGGCCAGAGAGTTGGCCCAGCAGATTGGAAGCCACCACATCA
GT
CTCAACATCGATCCAGCCGTGAAGGCCGTCATGGGCATCTTCAGCCTGGTGACGGGGAAGAGCCCTCT
G
TTTGCAGCTCATGGAGGAAGCAGCAGGGAAAACCTGGCGCTGCAAAATGTGCAGGCTCGAATACGGATG
GTC
CTCGCCTATCTGTTTGCTCAGTTGAGCCTCTGGTCTCGGGGTGTCCACGGTGGGCTCCTCGTGCTGG
GA
TCCGCCAACGTGGATGAGAGTCTCCTGGGCTACCTGACCAAGTACGACTGCTCCAGTGCGGACATCAA
C
CCCATAGGCGGGATCAGCAAGACGGACCTCAGGGCCTTCGTCCAGTTCTGCATCCAGCGCTTCCAGCTT
CCT
GCCCTGCAGAGCATCCTGTTGGCGCCGGCCACCGCAGAGCTGGAGCCCTTGGCTGATGGACAGGTGT
CC
CAGACCGACGAGGAAGATATGGGGATGACATATGCGGAGCTCTCGGTCTATGGGAAACTCAGGAAGGT
G
GCCAAGATGGGGCCCTACAGCATGTTCTGCAAACTCCTCGGCATGTGGAGACACATCTGCACCCCGAGA
CAG
GTCGCTGACAAAGTGAAGCGGTTTTTCTCCAAGTACTCCATGAACAGACACAAGATGACCACGCTCA
CA
CCCGCGTACCACGCCGAGAACTACAGCCCTGAGGACAACAGGTTTGATCTGCGACCATTTCTGTACAA
C
ACAAGCTGGCCTTGGCAGTTTCGGTGCATAGAAAATCAGGTGCTACAGCTCGAGAGGGCAGAGCCACAG
TCC
CTGGACGGCGTGGACTGA


Translation (706 aa):
MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRGARYRLGPELEICGYGCWDHYYESDTLLHSFQVL
A
ALVESPVTQDIICDVG
MPVMHRNVRYNCRVIFLNRKILLIRPKMALANEGNYRELRWFTPWSRSRHTEE
Y
FLPRMIQDLTKQ
ETVPFGDAVLVTWDTCIGSEICEELWTPHSPHIDMGLDGVEIITNASGSHQVLRKAN
T
RVDLVTMVTSK
NGGIYLLANQKGCDGDRLYYDGCAMIAMNGSVFAQGSQFSLDDVEVLTATLDLEDVRS
Y
RAEISSRNLA
ASRASPYPRVKVDFALSCHEDLLAPISEPIEWKYHSPEEEISLGPACWLWDFLRRSQQA
G
FLLPLSGGVDSAATACLIYSMCCQVCEAVRSG
NEEVLADVRTIVNQISYTPQDPRDLCGRILTTCYMAS
K
NSSQETCTRARELAQQIG
SHHISLNIDPAVKAVMGIFSLVTGKSPLFAAHGGSSRENLALQNVQARIRM
V
LAYLFAQLSLWSRGVHGGLLVLGSANVDE
SLLGYLTKYDCSSADINPIGGISKTDLRAFVQFCIQRFQL
P
ALQ
SILLAPATAELEPLADGQVSQTDEEDMGMTYAELSVYGKLRKVAKMGPYSMFCKLLGMWRHICTPR
Q
VADKVKRFFSKYSMNRHKMTTLTPAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQ
S
LDGVD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser