NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS81829.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
81829.1 Public Homo sapiens 14 ZC2HC1C 24 110 108 CCDS HistoryNCBI Gene:79696Re-query CCDS DB by CCDS ID:81829.1Re-query CCDS DB by GeneID:79696See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 20, NCBI annotation release 108, Ensembl annotation release 85

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 81829.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000238686.8 ENSP00000238686.8 Accepted alive Link to Ensembl Transcript Viewer:ENST00000238686.8Link to Ensembl Protein Viewer:ENSP00000238686.8Re-query CCDS DB by Nucleotide ID:ENST00000238686Re-query CCDS DB by Protein ID:ENSP00000238686
Original member Current member NCBI NM_001330191.2 NP_001317120.1 Accepted alive Link to Nucleotide Sequence:NM_001330191.2Link to Protein Sequence:NP_001317120.1Re-query CCDS DB by Nucleotide ID:NM_001330191Re-query CCDS DB by Protein ID:NP_001317120Link to BLAST:NP_001317120.1

Chromosomal Locations for CCDS 81829.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 75070574 75071738 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 75077532 75077536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1170 nt):
ATGGCTGGTCTCCAGCGGTTGGCGTCACATCTGCCTGTGGGCGTTATGCTCCCACATAATACAACGGAAG
CT
CCAGGGCCCCACTCAGCCAAGCAAGACTCTTACGAACAAGGTGACTCTTCCCAGCAGTCCTTGAAGGG
G
CACCTGAGGAACAATTTCCAGAAGCAGCTTTTGAGCAACAAAGAGTTGATTCTGGATAAAGTCTATACT
CAC
CCCAAATGGAACACCCAAACAAAAGCCCGGAGCTACTCCTATCCCCACTGTACTGGAATCAGCCAGC
AA
GATCCAGAAAGTGATTCCCAGGGCCAAGGAAATGGTTTGTTTTACTCGTCAGGCCCTCAATCCTGGTA
T
CCCAAAGCCAATAACCAGGACTTTATCCCCTTTACAAAGAAACGAGTTGGAGTGGACCGGGCGTTCCCA
TTG
AAACCCATGGTCCACAGGAAGTCGTGCAGTACAGGTGAGGCTGGCACTGATGGGGACCATAATGTCT
AC
CCAAGGCCCCCTGAGCCGAGAGAGTTTTCATCTAGGAACTTTGGTGTGAGGAACCAGGGCAACTTTTC
T
GTGGTTGGTACTGTTCTTGCTGCCACGCAGGCGGAGAAGGCCGTGGCAAACTTTGACAGGACGGAGTGG
GTG
CAGATCCGAAGACTAGAAGCTGCAGGGGAGAGCTTAGAGGAGGAAATCCGAAGAAAGCAGATTCTCC
TG
AGGGGAAAGCTGAAGAAGACAGAGGAGGAACTCAGAAGGATCCAGACGCAAAAGGAACAGGCCAAGGA
A
AATGAAAACGGAGAGCTACAGAAAATTATACTCCCCAGGAGCAGAGTTAAAGGTAATAAAAGCAACACC
ATG
TACAAACCTATCTTCTCCCCAGAATTTGAGTTTGAGGAAGAATTTAGTAGAGACAGGAGAGAGGATG
AA
ACTTGGGGACGGTCTCAACAAAATTCAGGTCCATTCCAGTTCTCTGATTATAGAATCCAGAGGCTCAA
A
AGGGAAAGGCTGGTAGCAAGCAATAATAAAATTCGAGACCCAGTCTCAGAGCCATCGGTGGAGAAATTC
TCC
CCGCCTTCAGAAACACCAGTCGGTGCTTTGCAGGGATCCGCCAGAAATTCCAGCCTGTCCATGGCAC
CA
GACTCCTCAGGTTCCAGCGGCTCCATTGAAGAGCCACAGCTGGGCTGA


Translation (389 aa):
MAGLQRLASHLPVGVMLPHNTTEAPGPHSAKQDSYEQGDSSQQSLKGHLRNNFQKQLLSNKELILDKVYT
H
PKWNTQTKARSYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFP
L
KPMVHRKSCSTGEAGTDGDHNVYPRPPEPREFSSRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEW
V
QIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQKEQAKENENGELQKIILPRSRVKGNKSNT
M
YKPIFSPEFEFEEEFSRDRREDETWGRSQQNSGPFQFSDYRIQRLKRERLVASNNKIRDPVSEPSVEKF
S
PPSETPVGALQGSARNSSLSMAPDSSGSSGSIEEPQL
G



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser