NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8179.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8179.1 Public Homo sapiens 11 CHKA 22 109 92 CCDS HistoryNCBI Gene:1119Re-query CCDS DB by CCDS ID:8179.1Re-query CCDS DB by GeneID:1119See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8179.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000356135.9 ENSP00000348454.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000356135.9Link to Ensembl Protein Viewer:ENSP00000348454.4Re-query CCDS DB by Nucleotide ID:ENST00000356135Re-query CCDS DB by Protein ID:ENSP00000348454
Original member NCBI NM_212469.1 NP_997634.1 Updated not alive Link to Nucleotide Sequence:NM_212469.1Link to Protein Sequence:NP_997634.1Re-query CCDS DB by Nucleotide ID:NM_212469Re-query CCDS DB by Protein ID:NP_997634
Current member NCBI NM_212469.2 NP_997634.1 Accepted alive Link to Nucleotide Sequence:NM_212469.2Link to Protein Sequence:NP_997634.1Re-query CCDS DB by Nucleotide ID:NM_212469Re-query CCDS DB by Protein ID:NP_997634Link to BLAST:NP_997634.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_997634.1 439 P35790-2 439 100% 0 0

Chromosomal Locations for CCDS 8179.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 68053988 68054047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68061953 68062034 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68064525 68064631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68065786 68065894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68066429 68066516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68068879 68068937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68070189 68070293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68070724 68070857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68074717 68074830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68097019 68097130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68120828 68121177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1320 nt):
ATGAAAACCAAATTCTGCACCGGGGGCGAGGCGGAGCCCTCGCCGCTCGGGCTGCTGCTGAGCTGCGGTA
GC
GGCAGCGCGGCCCCGGCGCCCGGCGTGGGGCAGCAGCGCGACGCCGCCAGCGACCTCGAGTCCAAGCA
G
CTGGGCGGCCAACAGCCGCCGCTCGCGCTGCCCCCTCCGCCGCCGCTGCCGCTGCCGCTGCCGCTGCCC
CAG
CCCCCGCCGCCGCAGCCGCCCGCAGACGAGCAGCCGGAGCCCCGGACGCGGCGCAGGGCCTATCTGT
GG
TGCAAGGAGTTCCTGCCCGGCGCCTGGCGGGGCCTCCGCGAGGACGAGTTCCACATCAGTGTCATCAG
A
GGCGGCCTTAGCAACATGCTGTTCCAGTGCTCCCTACCTGACACCACAGCCACCCTTGGTGATGAGCCT
CGG
AAAGTGCTCCTGCGGCTGTATGGAGCGATTTTGCAGATGGGGGCTGAGGCCATGGTTCTGGAGAGCG
TT
ATGTTTGCCATTCTCGCAGAGAGGTCACTTGGGCCAAAACTCTATGGCATCTTTCCCCAAGGCCGACT
G
GAGCAGTTCATCCCGAGCCGGCGATTAGATACTGAAGAATTAAGTTTGCCAGATATTTCTGCAGAAATC
GCC
GAGAAAATGGCTACATTTCATGGTATGAAAATGCCATTCAATAAGGAACCAAAATGGCTTTTTGGCA
CA
ATGGAAAAGTATCTAAAGGAAGTGCTGAGAATTAAATTTACTGAGGAATCCAGAATTAAAAAGCTCCA
C
AAATTGCTCAGTTACAATCTGCCCTTGGAACTGGAAAACCTGAGATCATTGCTTGAATCTACTCCATCT
CCA
GTTGTATTTTGTCATAATGACTGTCAAGAAGGTAATATCTTGTTGCTGGAAGGCCGAGAGAATTCTG
AA
AAACAGAAACTGATGCTCATTGATTTCGAATACAGCAGTTACAATTACAGGGGATTCGACATTGGAAA
T
CACTTCTGTGAGTGGATGTATGATTATAGCTATGAAAAATACCCTTTTTTCAGAGCAAACATCCGGAAG
TAT
CCCACCAAGAAACAACAGCTCCATTTTATTTCCAGTTACTTGCCTGCATTCCAAAATGACTTTGAAA
AC
CTCAGTACTGAAGAAAAATCCATTATAAAAGAAGAAATGTTGCTTGAAGTTAATAGGTTTGCCCTTGC
A
TCTCATTTCCTCTGGGGACTGTGGTCCATTGTACAAGCCAAGATTTCATCTATTGAATTTGGGTACATG
GAC
TACGCCCAAGCAAGGTTTGATGCCTATTTCCACCAGAAGAGGAAGCTTGGGGTGTGA


Translation (439 aa):
MKTKFCTGGEAEPSPLGLLLSCGSGSAAPAPGVGQQRDAASDLESKQLGGQQPPLALPPPPPLPLPLPLP
Q
PPPPQPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVI
RGGLSNMLFQCSLPDTTATLGDEP
R
KVLLRLYGAILQM
GAEAMVLESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
A
EKMATFHGMKMPFNKEPKWLFGTME
KYLKEVLRIKFTEESRIKKLHKLLSYNLPLELENLRSLLESTPS
P
VVFCHNDCQE
GNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFFRANIRK
Y
PTKKQQ
LHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLWGLWSIVQAKISSIEFGYM
D
YAQARFDAYFHQKRKLGV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser