NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS81504.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
81504.1 Public Homo sapiens 10 TCF7L2 22 109 92 CCDS HistoryNCBI Gene:6934Re-query CCDS DB by CCDS ID:81504.1Re-query CCDS DB by GeneID:6934See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 20, NCBI annotation release 108, Ensembl annotation release 85

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 81504.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000369395.6 ENSP00000358402.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000369395.6Link to Ensembl Protein Viewer:ENSP00000358402.2Re-query CCDS DB by Nucleotide ID:ENST00000369395Re-query CCDS DB by Protein ID:ENSP00000358402
Original member Current member NCBI NM_001198527.1 NP_001185456.1 Accepted alive Link to Nucleotide Sequence:NM_001198527.1Link to Protein Sequence:NP_001185456.1Re-query CCDS DB by Nucleotide ID:NM_001198527Re-query CCDS DB by Protein ID:NP_001185456Link to BLAST:NP_001185456.1

Chromosomal Locations for CCDS 81504.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 112950757 112950945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 112951207 112951273 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 112951483 112951607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 113040025 113040126 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 113141184 113141316 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 113143923 113144013 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 113146011 113146097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 113150998 113151123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 113151725 113151884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 113152333 113152440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 113158021 113158069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 113158667 113158717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 113159920 113159992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 113161579 113161585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1368 nt):
ATGCCGCAGCTGAACGGCGGTGGAGGGGATGACCTAGGCGCCAACGACGAACTGATTTCCTTCAAAGACG
AG
GGCGAACAGGAGGAGAAGAGCTCCGAAAACTCCTCGGCAGAGAGGGATTTAGCTGATGTCAAATCGTC
T
CTAGTCAATGAATCAGAAACGAATCAAAACAGCTCCTCCGATTCCGAGGCGGAAAGACGGCCTCCGCCT
CGC
TCCGAAAGTTTCCGAGACAAATCCCGGGAAAGTTTGGAAGAAGCGGCCAAGAGGCAAGATGGAGGGC
TC
TTTAAGGGGCCACCGTATCCCGGCTACCCCTTCATCATGATCCCCGACCTGACGAGCCCCTACCTCCC
C
AACGGATCGCTCTCGCCCACCGCCCGAACCTATCTCCAGATGAAATGGCCACTGCTTGATGTCCAGGCA
GGG
AGCCTCCAGAGTAGACAAGCCCTCAAGGATGCCCGGTCCCCATCACCGGCACACATTGTCTCTAACA
AA
GTGCCAGTGGTGCAGCACCCTCACCATGTCCACCCCCTCACGCCTCTTATCACGTACAGCAATGAACA
C
TTCACGCCGGGAAACCCACCTCCACACTTACCAGCCGACGTAGACCCCAAAACAGGAATCCCACGGCCT
CCG
CACCCTCCAGATATATCCCCGTATTACCCACTATCGCCTGGCACCGTAGGACAAATCCCCCATCCGC
TA
GGATGGCAAGGTCAACCAGTGTACCCAATCACGACAGGAGGATTCAGACACCCCTACCCCACAGCTCT
G
ACCGTCAATGCTTCCATGTCCAGGTTCCCTCCCCATATGGTCCCACCACATCATACGCTACACACGACG
GGC
ATTCCGCATCCGGCCATAGTCACACCAACAGTCAAACAGGAATCGTCCCAGAGTGATGTCGGCTCAC
TC
CATAGTTCAAAGCATCAGGACTCCAAAAAGGAAGAAGAAAAGAAGAAGCCCCACATAAAGAAACCTCT
T
AATGCATTCATGTTGTATATGAAGGAAATGAGAGCAAAGGTCGTAGCTGAGTGCACGTTGAAAGAAAGC
GCG
GCCATCAACCAGATCCTTGGGCGGAGGTGGCATGCACTGTCCAGAGAAGAGCAAGCGAAATACTACG
AG
CTGGCCCGGAAGGAGCGACAGCTTCATATGCAACTGTACCCCGGCTGGTCCGCGCGGGATAACTATGG
A
AAGAAGAAGAAGAGGAAAAGGGACAAGCAGCCGGGAGAGACCAATGAACACAGCGAATGTTTCCTAAAT
CCT
TGCCTTTCACTTCCTCCGATTACAGACCTGAGCGCTCCTAAGAAATGCCGAGCGCGCTTTGGCCTTG
AT
CAACAGAATAACTGGTGCGGCCCTTGCAGTCTTTGA


Translation (455 aa):
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPP
R
SESFRDKSRESLEE
AAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTYLQMKWPLLDVQA
G
SLQSRQALKDARSPSPAHIV
SNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRP
P
HPPDISPYYPLSPGTVGQIPHPLG
WQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTT
G
IPHPAIVTPTVKQESSQSDVGSLHS
SKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKES
A
AINQILGRR
WHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLN
P
CLSLPPIT
DLSAPKKCRARFGLDQQNNWCGPCSL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser