NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS80945.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
80945.1 Public Mus musculus 8 Pard3 23 108 98 CCDS HistoryNCBI Gene:93742Re-query CCDS DB by CCDS ID:80945.1Re-query CCDS DB by GeneID:93742See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 19, NCBI annotation release 105, Ensembl annotation release 81

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 80945.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000160272.7 ENSMUSP00000125453.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160272.7Link to Ensembl Protein Viewer:ENSMUSP00000125453.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000160272Re-query CCDS DB by Protein ID:ENSMUSP00000125453
Original member Current member NCBI NM_001309391.1 NP_001296320.1 Accepted alive Link to Nucleotide Sequence:NM_001309391.1Link to Protein Sequence:NP_001296320.1Re-query CCDS DB by Nucleotide ID:NM_001309391Re-query CCDS DB by Protein ID:NP_001296320Link to BLAST:NP_001296320.1

Chromosomal Locations for CCDS 80945.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 127064354 127064473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127161210 127161311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127277021 127277201 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127306330 127306508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127324041 127324172 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127357275 127357366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127359727 127359810 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127370248 127370373 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127371496 127371878 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127376744 127376883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127378186 127378314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127380465 127380503 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127388510 127388698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127389328 127389498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127398600 127398750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127405375 127405564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127409556 127409707 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127410729 127410773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127415570 127415797 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127426522 127426753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127460274 127460384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127474379 127474615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127593061 127593181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127603059 127603186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 127610432 127610774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4005 nt):
ATGAAAGTGACCGTGTGCTTCGGGAGGACCCGGGTGGTCGTGCCGTGCGGAGATGGCCGCATGAAAGTTT
TC
AGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCGTGGCCAAGGATCCAAACTACTGGATACA
G
GTGCATCGCTTGGAGCATGGAGATGGAGGGATTCTAGACCTGGATGACATCCTCTGTGACGTTGCTGAT
GAC
AAAGACAGACTGGTAGCAGTATTTGATGAACAGGATCCCCACCATGGAGGAGATGGTACCAGCGCCA
GC
TCCACGGGAACCCAGAGTCCAGAGATATTCGGCAGTGAGCTGGGCACCAACAATGTTTCTGCTTTTCA
G
CCTTATCAAGCCACAAGTGAAATTGAGGTCACGCCTTCAGTTCTTCGGGCAAATATGCCTCTTCATGTC
CGC
CGGAGCAGCGACCCAGCTTTAACTGGCCTTTCCACTTCTGTCAGTGATAACAACTTTTCCTCAGAGG
AG
CCCTCCAGGAAAAACCCCACCCGCTGGTCCACGACAGCTGGCTTTCTCAAGCAGAACACCGCTGGAAG
T
CCCAAAACCTGCGACAGGAAGAAAGATGAAAACTACAGAAGCCTTCCACGGGATCCCAGTAGCTGGTCC
AAC
CAGTTCCAGCGAGACAACGCCCGCTCCTCCCTGAGCGCCAGCCACCCAATGGTAGACCGGTGGCTGG
AG
AAGCAAGAACAGGATGAGGAAGGCACAGAAGAAGACAGCAGCCGAGTGGAGCCGGTTGGACATGCTGA
T
ACCGGATTGGAGAACATGCCCAACTTTTCCCTCGATGATATGGTAAAGCTCGTACAAGTCCCCAACGAT
GGA
GGGCCCCTGGGAATCCATGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACATTGGGGTTGTTAGTGA
AG
CGGTTGGAGAAAGGCGGTAAGGCTGAGCAAGAAAACCTTTTCCATGAGAATGACTGCATTGTGAGGAT
T
AACGATGGAGATCTTCGAAACAGAAGATTTGAGCAAGCACAACATATGTTCCGCCAAGCTATGCGTGCG
CGT
GTCATTTGGTTCCATGTGGTCCCTGCAGCAAACAAGGAGCAATATGAACAACTGTCCCAACGCGAGA
AG
AACAACTACTCCCCAGGCCGCTTCAGCCCTGACAGCCACTGTGTGGCCAACAGGAGTGTGGCCAACAA
T
GCCCCTCAAGCATTGCCCAGAGCACCCAGACTGAGTCAGCCACCCGAGCAGCTGGATGCTCACCCCCGA
CTA
CCTCATAGTGCTCACGCCTCAACCAAACCACCCGCAGCCCCGGCCTTGGCTCCACCCAGTGTGCTTA
GT
ACCAACGTAGGCAGTGTGTACAACACGAAGAAAGTAGGCAAGAGGCTCAACATCCAGCTTAAGAAAGG
T
ACAGAAGGACTGGGATTCAGCATCACCTCCCGGGACGTCACCATAGGTGGCTCAGCTCCCATTTATGTC
AAG
AATATCCTTCCTCGAGGGGCTGCCATTCAGGATGGCAGACTCAAGGCAGGAGACCGGCTAATAGAGG
TC
AATGGAGTAGATTTAGCAGGCAAATCCCAGGAGGAAGTTGTTTCCCTGTTGAGAAGCACCAAGATGGA
G
GGGACTGTGAGCCTTCTGGTCTTTCGTCAGGAAGAGGCTTTCCACCCAAGGGAAATGAATGCTGAACCA
AGC
CAGATGCAGACTCCAAAAGAAACGAAAGCTGAAGATGAGGACGTTGTTCTCACACCCGATGGTACCA
GG
GAGTTTCTGACTTTTGAAGTTCCACTGAATGACTCAGGATCTGCAGGGCTTGGTGTCAGTGTCAAGGG
G
AACCGTTCCAAAGAGAACCACGCAGATTTGGGGATCTTCGTTAAATCCATTATCAATGGTGGAGCTGCA
TCT
AAAGATGGAAGGCTGAGGGTAAATGACCAGCTGATAGCTGTGAATGGAGAATCTCTACTGGGCAAAG
CC
AACCAGGAAGCCATGGAGACTCTACGGAGGTCCATGTCCACCGAGGGCAACAAGCGTGGCATGATCCA
G
CTCATTGTGGCGAGGCGGATCAGCAGATGTAACGAGCTGCGGTCTCCTGGGAGCCCTGCTGCACCTGAG
CTG
CCCATCGAGACAGAACTGGATGACCGAGAACGCAGGATCTCACACTCCCTCTACAGTGGGATCGAGG
GG
CTGGATGAGTCGCCCACCAGGAACGCAGCACTGAGCAGGATAATGGGTAAATGCCAGCTGTCCCCCAC
G
GTGAACATGCCTCACGATGACACTGTCATGATTGAAGATGACAGGCTGCCTGTGCTCCCTCCTCACCTC
TCT
GACCAGTCCTCCTCCAGCTCCCATGATGACGTTGGATTCATAATGACAGAAGCAGGCACGTGGGCCA
AA
GCTACCATCAGTGACTCAGCCGACTGCTCATTGAGTCCAGATGTTGATCCGGTTCTCGCTTTTCAACG
G
GAAGGATTTGGACGCCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGTCAATTGGAT
TTC
GTTAAAACACGAAAATCAAAAAGCATGGATTTAGGTATAGCTGACGAGACTAAACTCAATACAGTGG
AT
GACCAGAGAGCAGGCTCTCCCAGTAGAGATGTGGGACCCTCCTTAGGTCTGAAGAAATCTAGCTCCTT
A
GAAAGTCTGCAGACCGCTGTCGCCGAGGTGACGCTGAACGGGAACATTCCTTTCCACCGCCCTCGGCCA
CGA
ATCATCCGGGGAAGGGGCTGCAACGAAAGCTTCAGAGCCGCCATTGACAAGTCCTACGACAAGCCCA
TG
GTTGATGATGACGACGAAGGCATGGAGACCTTGGAAGAAGACACAGAGGAAAGCTCGAGGTCAGGGAG
G
GAGTCCGTGTCCACGTCCAGCGATCAGCCTTCCTATTCTCTGGAGAGGCAAATGAATGGAGACCCAGAG
AAA
AGGGACAAGACAGAGAGGAAAAAGGACAAAGCCGGAAAGGATAAGAAGAAAGACCGAGAGAAGGAGA
AG
GATAAACTGAAAGCCAAGAAGGGGATGCTGAAAGGCTTGGGGGACATGTTCAGGTTTGGCAAACATCG
A
AAAGATGACAAGATGGAAAAAATGGGTCGAATAAAAATCCAGGATTCTTTCACCTCAGAAGAGGACAGG
GTG
CGGATGAAGGAAGAACAGGAGAGGATTCAAGCCAAAACTCGAGAGTTTAGGGAGCGGCAAGCCCGAG
AG
CGTGACTATGCAGAGATCCAAGATTTCCATCGGACGTTTGGCTGTGATGACGAGTTGCTGTATGGGGG
C
ATGTCATCCTATGAAGGCTGCTTGGCTCTCAATGCCAGACCCCAGAGCCCAAGAGAAGGGCACCTGATG
GAC
ACTTTGTATGCCCAAGTAAAGAAACCTCGGAGCTCCAAACCTGGAGACAGCAATCGATCCACTCCTA
GC
AACCATGACCGGATACAGCGTCTACGGCAAGAGTTCCAGCAAGCCAAACAGGATGAGGATGTGGAAGA
C
CGGCGCCGTACCTACAGCTTTGAGCAATCTTGGTCCAGCTCGCGGCCGGCATCGCAGAGTGGTCGGCAC
TCG
GTGTCCGTGGAGGTTCAAGTACAACGGCAGCGCCAGGAGGAGCGAGAGAGCTTCCAGCAGGCCCAGC
GC
CAGTACAGCTCACTGCCAAGACAAAGCAGGAAGAATGCCAGCTCCATATCACAGGATTCCTGGGAACA
G
AACTACGCCCCTGGTGAAGGCTTCCAGAGTGCCAAGGAGAACCCCAGGTATTCCAGTTACCAGGGCTCA
AGG
AACGGCTATCTAGGCGGGCACGGCTTTAATGCCAGGGTCATGCTGGAGACCCAGGAGCTTCTCCGAC
AG
GAACAGAGGCGGAAAGAGCAGCAGCTGAAGAAGCAGCCTCCAGCTGATGGAGTCAGAGGGCCCTTCCG
G
CAAGATGTGCCCCCTTCTCCATCTCAGGTGGCTAGGCTGAACAGACTGCAGACACCGGAGAAAGGGCGG
CCC
TTCTACTCCTGA


Translation (1334 aa):
MKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILDLDDILCDVAD
D
KDR
LVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHV
R
RSSDPALTGLSTSVSDNNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRK
KDENYRSLPRDPSSWS
N
QFQRDNARSSLSASHPMVDRWLEKQEQ
DEEGTEEDSSRVEPVGHADTGLENMPNFSLDDMVKLVQVPND
G
GPLGIHVVPFSARGG
RTLGLLVKRLEKGGKAEQENLFHENDCIVRINDGDLRNRRFEQAQHMFRQAMRA
R
VIWFHVVPAANKEQYEQLSQREKNNYSPGRFSPDSHCVANRSVANNAPQALPRAPRLSQPPEQLDAHPR
L
PHSAHASTKPPAAPALAPPSVLSTNVGSVYNTKKVGKRLNIQLKK
GTEGLGFSITSRDVTIGGSAPIYV
K
NILPRGAAIQDGRLKAGDRLIE
VNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEAFHPREMNAEP
S
QMQTPKET
KAEDEDVVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAA
S
K
DGRLRVNDQLIAVNGESLLGKANQEAMETLRRSMSTEGNKRGMIQLIVARRISRCNELRSPGSPAAPE
L
PIETELDDRERRISHSLYSGIEGLDESPTRNAALSRIM
GKCQLSPTVNMPHDDTVMIEDDRLPVLPPHL
S
DQSSSSSHDDVGFIMTEAGTWAKATISDSAD
CSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLD
F
VKTRKSKSMDLG
IADETKLNTVDDQRAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGNIPFHRPRP
R
IIRGRGCNESFRAAIDKSYDKPMVDDDDEGMET
LEEDTEESSRSGRESVSTSSDQPSYSLERQMNGDPE
K
RDKTERKKDKAGKDKKKDREKEKDKLKAKKGMLKGLGDMF
RFGKHRKDDKMEKMGRIKIQDSFTSEEDR
V
RMKEEQE
RIQAKTREFRERQARERDYAEIQDFHRTFGCDDELLYGGMSSYEGCLALNARPQSPREGHLM
D
TLYAQVKKPRSSKPGD
SNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQSWSSSRPASQSGRH
S
VSVEVQVQRQRQEERESFQQAQRQYSSLP
RQSRKNASSISQDSWEQNYAPGEGFQSAKENPRYSSYQGS
R
NGYLGGHGFNARVMLETQELLRQEQRRKEQQLKKQPPADGVRGPFRQDVPPSPSQVARLNRLQTPEKGR
P
FYS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser