NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS80.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
80.1 Public Homo sapiens 1 NOL9 24 110 108 CCDS HistoryNCBI Gene:79707Re-query CCDS DB by CCDS ID:80.1Re-query CCDS DB by GeneID:79707See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 80.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000377705.6 ENSP00000366934.5 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000377705.6Link to Ensembl Protein Viewer:ENSP00000366934.5Re-query CCDS DB by Nucleotide ID:ENST00000377705Re-query CCDS DB by Protein ID:ENSP00000366934
Original member Current member NCBI NM_024654.5 NP_078930.4 MANE Select Accepted alive Link to Nucleotide Sequence:NM_024654.5Link to Protein Sequence:NP_078930.4Re-query CCDS DB by Nucleotide ID:NM_024654Re-query CCDS DB by Protein ID:NP_078930Link to BLAST:NP_078930.4

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_078930.4 702 Q5SY16 702 100% 0 0

Chromosomal Locations for CCDS 80.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 6525854 6526003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 6526696 6526829 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 6528994 6529171 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 6531968 6532079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 6532463 6532760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 6533280 6533441 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 6541830 6541927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 6544826 6544922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 6545045 6545180 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 6549571 6549698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 6550396 6550615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 6554107 6554502 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2109 nt):
ATGGCGGACTCGGGACTGCTGCTAAAGCGGGGTTCCTGCCGTTCCACTTGGCTGCGGGTCCGCAAGGCCC
GG
CCCCAGCTCATCCTCAGCCGCCGGCCCCGCCGCCGGCTCGGGAGCCTGCGCTGGTGCGGTCGGCGGCG
C
CTACGGTGGCGGTTACTGCAAGCCCAGGCGTCCGGCGTGGACTGGAGGGAGGGAGCCCGCCAGGTGTCG
CGC
GCGGCGGCGGCCCGGAGACCCAACACCGCGACCCCCAGCCCGATCCCTAGCCCGACCCCGGCCTCCG
AA
CCCGAGTCCGAACCCGAACTCGAATCCGCCTCGAGTTGCCACCGGCCTCTCCTCATCCCACCGGTGCG
G
CCCGTGGGCCCCGGCCGCGCGTTGCTGCTGCTGCCGGTCGAGCAGGGTTTTACTTTTAGTGGGATCTGT
CGT
GTGACTTGCCTCTATGGCCAGGTGCAGGTATTTGGTTTTACCATCAGCCAAGGCCAGCCTGCCCAAG
AC
ATCTTCTCTGTGTATACCCACTCTTGCTTGAGTATCCATGCACTTCACTACTCACAGCCTGAGAAAAG
C
AAGAAGGAACTGAAAAGGGAAGCCCGGAATTTGCTCAAATCTCATCTTAACCTTGATGACAGGCGTTGG
TCG
ATGCAGAATTTTTCTCCTCAGTGTTCCATTGTGTTGCTAGAACATCTGAAAACTGCCACTGTAAACT
TC
ATAACCAGCTATCCGGGTTCATCCTACATTTTTGTGCAAGAGAGTCCAACTCCCCAGATTAAACCTGA
A
TATTTAGCCTTGAGGTCTGTTGGCATCAGAAGAGAGAAAAAAAGGAAAGGCCTTCAGTTAACTGAGAGT
ACC
CTTTCAGCCCTGGAAGAGTTAGTCAATGTTTCCTGTGAAGAAGTAGATGGCTGCCCTGTCATTCTAG
TT
TGTGGATCCCAGGATGTTGGAAAGTCAACATTTAATAGATACCTGATTAACCATTTGTTAAATAGTCT
T
CCCTGCGTTGACTATTTGGAATGTGATCTGGGACAGACAGAATTTACCCCTCCTGGTTGCATTTCTTTG
CTT
AATATTACAGAACCAGTTCTGGGACCACCTTTCACTCACCTGAGGACTCCACAGAAGATGGTATATT
AT
GGGAAACCTTCTTGTAAAAACAACTATGAGAATTATATTGACATAGTGAAATATGTGTTCAGCGCTTA
C
AAGAGAGAGTCCCCTCTCATCGTCAACACTATGGGATGGGTTTCAGACCAGGGGCTCCTGCTTCTCATT
GAT
CTGATCCGATTGCTGTCTCCCAGCCACGTGGTTCAGTTCCGCTCTGACCACAGTAAATATATGCCAG
AC
CTTACCCCGCAGTATGTAGATGACATGGATGGCTTGTACACAAAAAGCAAGACCAAGATGAGAAATCG
A
CGTTTCAGACTCGCAGCATTTGCAGATGCTTTGGAATTTGCTGATGAAGAAAAAGAGAGTCCAGTTGAG
TTC
ACTGGACATAAACTGATAGGTGTTTATACAGACTTTGCATTCAGAATAACTCCAAGAAATAGAGAGT
CA
CATAACAAAATTCTTCGAGATCTGTCCATCTTGAGTTACCTTAGCCAGCTGCAGCCCCCGATGCCCAA
A
CCACTTTCTCCTTTACATAGCCTGACACCCTATCAGGTCCCTTTCAATGCAGTCGCACTCCGGATTACC
CAC
TCTGATGTCGCCCCTACCCATATACTATATGCTGTAAACGCCAGCTGGGTTGGTCTTTGCAAGATCC
AG
GATGACGTCAGAGGATACACGAATGGGCCCATCCTGCTTGCCCAGACTCCAATCTGTGACTGCTTGGG
C
TTTGGCATCTGTAGAGGCATTGACATGGAGAAGCGGCTGTACCACATCCTCACCCCTGTGCCCCCGGAA
GAG
CTAAGGACCGTGAATTGTCTGCTCGTTGGAGCTATTGCCATTCCACATTGTGTCCTTAAGTGCCAGC
GT
GGGATCGAAGGGACAGTACCTTATGTCACAACGGATTACAATTTTAAACTTCCTGGAGCATCAGAGAA
A
ATTGGAGCAAGAGAACCTGAGGAGGCACATAAAGAGAAACCATACCGAAGACCTAAGTTCTGTCGAAAA
ATG
AAGTGA


Translation (702 aa):
MADSGLLLKRGSCRSTWLRVRKARPQLILSRRPRRRLGSLRWCGRRRLRWRLLQAQASGVDWREGARQVS
R
AAAARRPNTATPSPIPSPTPASEPESEPELESASSCHRPLLIPPVRPVGPGRALLLLPVEQ
GFTFSGIC
R
VTCLYGQVQVFGFTISQGQPAQDIFSVYTHSCLSIHALHYSQPEKSKKELKREARNLLKSHLNL
DDRRW
S
MQNFSPQCSIVLLEHLKTATVNFITSYPGSSYIFVQE
SPTPQIKPEYLALRSVGIRREKKRKGLQLTES
T
LSALEELVNVSC
EEVDGCPVILVCGSQDVGKSTFNRYLINHLLNSLPCVDYLECDLGQTEFTPPGCISL
L
NITEPVL
GPPFTHLRTPQKMVYYGKPSCKNNYENYIDIVKYVFSAYKRESPLIVNTMGWVSDQGLLLLI
D
LIRLLSPSHVVQFRSDHSKYMPDLTPQYVDDMDGLYTKSKTKMRNRRFRLAAFADALEFADEEKESPVE
F
TGHKLIGVYTDFAFRITPRN
RESHNKILRDLSILSYLSQLQPPMPKPLSPLHSLTPYQVPFNAVALRIT
H
SDVAPTHILYAVNASWVGLCKIQDDVRGYTNGPILLAQTPICDCLGF
GICRGIDMEKRLYHILTPVPPE
E
LRTVNCLLVGAIAIPHCVLKCQ
RGIEGTVPYVTTDYNFKLPGASEKIGAREPEEAHKEKPYRRPKFCRK
M
K




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser