NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, January 22, 2020, starting at 8:00 a.m. EST for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS79165.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
79165.1 Public Mus musculus 13 Amph 23 108 98 CCDS HistoryNCBI Gene:218038Re-query CCDS DB by CCDS ID:79165.1Re-query CCDS DB by GeneID:218038See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 19, NCBI annotation release 105, Ensembl annotation release 81

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 79165.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000200466.4 ENSMUSP00000142766.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000200466.4Link to Ensembl Protein Viewer:ENSMUSP00000142766.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000200466Re-query CCDS DB by Protein ID:ENSMUSP00000142766
Original member Current member NCBI NM_001289546.1 NP_001276475.1 Accepted alive Link to Nucleotide Sequence:NM_001289546.1Link to Protein Sequence:NP_001276475.1Re-query CCDS DB by Nucleotide ID:NM_001289546Re-query CCDS DB by Protein ID:NP_001276475Link to BLAST:NP_001276475.1

Chromosomal Locations for CCDS 79165.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 18948433 18948501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19045953 19046033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19077331 19077385 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19084205 19084299 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19086523 19086618 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19094753 19094860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19096007 19096092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19099893 19099968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19100572 19100654 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19102872 19103010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19104231 19104359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19113103 19113219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19116237 19116260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19118152 19118175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19120596 19120628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19121275 19121331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19125026 19125148 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19137536 19137742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19139172 19139432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19141965 19142066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 19149736 19149843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2073 nt):
ATGGCCGACATCAAGACGGGCATCTTCGCCAAAAACGTGCAAAAGCGCCTCAACCGCGCGCAGGAAAAGG
TC
CTCCAGAAGCTGGGGAAGGCTGACGAGACAAAAGATGAACAGTTTGAAGAATATGTCCAGAACTTCAA
A
CGGCAGGAGGCAGAGGGTACCAGACTTCAGCGAGAACTCCGGGGATATTTAGCAGCAATCAAAGGTATG
CAG
GAGGCCTCAATGAAGCTCACTGAATCTCTACATGAAGTCTACGAGCCAGACTGGTATGGACGGGAAG
AT
GTAAAGATGGTTGGTGAGAAGTGTGATGTGCTGTGGGAAGACTTCCATCAAAAGCTAGTGGATGGCTC
C
TTGCTGACACTGGACACCTACCTGGGCCAGTTTCCTGACATAAAGAATCGCATCGCTAAGCGCAGCAGG
AAG
CTTGTGGATTATGATAGTGCTCGCCATCACCTGGAGGCTCTGCAGAGTTCCAAACGGAAAGATGAGA
GT
CGGATCTCTAAGGCAGAAGAGGAGTTTCAGAAAGCACAGAAAGTGTTTGAAGAGTTCAATGTTGACTT
A
CAAGAAGAGTTGCCGTCATTGTGGTCAAGTCGAGTTGGCTTTTACGTCAATACTTTCAAAAATGTCTCC
AGC
CTTGAGGCCAAGTTTCATAAGGAAATCGCAGTGCTTTGCCACAAGCTCTATGAAGTGATGACGAAAC
TC
GGTGATCAGCATGCTGACAAGGCCTTCAGCATTCAAGGAGCTCCCAGTGACTCGGGTCCTCTTCGCAT
T
GCAAAGACACCATCACCTCCAGAGGAGCCTTCTCCCCTGCCCAGCCCCACGGCTAGTCCCAACCACACA
TTA
GCACCTGCATCTCCTGCCCCAGTGCGACCCAGATCACCTTCACAGACAAGGAAAGGGCCTCCTGTCC
CA
CCTCTGCCTAAAGTCACCCCAACAAAGGAACTGAAACAGGAGAACATCATCAATTTCTTTGAGGACAA
C
TTTGTACCAGAAATCAATGTGACAACACCTTCCCAGAACGAAGTCTTGGAGGTGAAGAAGGAAGAGACT
TTG
CTGGATTTGGACTTTGACCCTTTCAAGCCCGATGTGGCTCCGGCAGGTTCTGCTGCAGCGACCCACT
CT
CCCATGTCTCAGACATTGCCCTGGGACTTATGGACGACAAGCACTGATTTGGTACAACCAGCTTCTGG
G
GGTTCATTTAATGATTTCACCCAGGCCCAGGACACTTCATTATTCACCATGCAGACAGATCAGAATATG
GTA
GGTGGCTTGGCTGAAACTGAGCAGGCTCTACCTACAGAGCCCCAAGCCGAAGAGCCTCCTGCCACTG
CT
GCTGCACCTACTGCTGGGCTGGACCTTGGGCTAGAGATGGAGGAGCCAAAGGAGGAGGCTGTGATCCC
T
CCCGCAACTGATACTGGCGAGACTGTGGAAACTGCAGTGCCAACTGAGGGTGCCCCGGTGGAGGAAGCA
GAG
GCAGAGAAGGCAGCCCTCCCTGCTGGAGAAGGAGGAAGTCCAGAGGGAGCCAAAATTGACGGGGAAA
GC
ACGGAGCTTGCAATCAGTGAGAGCCCTCAACCAGTGGAGCCCGAAGCGGGTGCTCCTCAGGTCATCCC
T
TCTGTTGTCATTGAGCCAGCCTCCAACCATGAAGGAGAAGGAGAACACCAAGAAACTGCTACGGGTACT
GAA
CCGAGGGAGGCCGCTGAGGATGTGGCTGCCCAGGGCTCAGCGGGTGAGAAGCAGGAAGTGGCTACAG
AG
CCCACGCCTCTGGATTCTCAGGCAACTCTGCCTGCATCTGCAGGTGCTGTGGATGCCTCGCTGTCTGC
A
GGGGATGCCACTCAGGAACTGCCTCCTGGCTTTCTCTACAAGGTGGAAACCCTGCATGATTTCGAGGCA
GCG
AACTCTGATGAACTTAACCTACAAAGGGGTGACGTGGTACTCGTGGTGCCTTCAGACTCAGAAGCCG
AC
CAGGATGCAGGCTGGTTGGTGGGGGTGAAGGAGTCAGACTGGCTTCAGTACAGAGACCTGGCCACGTA
C
AAAGGCCTCTTTCCAGAGAACTTCACGCGGCGCCTGGAGTAG


Translation (690 aa):
MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGM
Q
EASMKLTESLHEVYEPDWYGREDVKMVGE
KCDVLWEDFHQKLVDGSLLTLDTYLGQFPDIKNRIAKRSR
K
LVDYDSARHHLEALQSSKRKDESRISK
AEEEFQKAQKVFEEFNVDLQEELPSLWSSRVGFYVNTFKNVS
S
LEAKFHKEIAV
LCHKLYEVMTKLGDQHADKAFSIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHT
L
APASPAPVRPRSPSQ
TRKGPPVPPLPKVTPTKELKQENIINFFEDNFVPEINVTTPSQNEVLEVKKEET
L
LDLDFDPFKPDVAPAGSAAATHSPMSQ
TLPWDLWTTSTDLVQPASGGSFNDFTQAQDTSLFTMQTDQNM
V
GGL
AETEQALPTEPQAEEPPATAAAPTAGLDLGLEMEEPKEEAVIPPATDTGETVETAVPTEGAPVEEA
E
AEKAALPAGEGGSPEGAKIDGESTELAISESPQPVEPEAGAPQ
VIPSVVIEPASNHEGEGEHQETATGT
E
PREAAEDVAAQGSAGEKQEVATEPTPLDSQATLPASAGAVDASLSAGDATQELPPGFLYK
VETLHDFEA
A
NSDELNLQRGDVVLVVPSDSEADQ
DAGWLVGVKESDWLQYRDLATYKGLFPENFTRRLE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser