NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS7866.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7866.1 Public Homo sapiens 11 BDNF 22 109 92 CCDS HistoryNCBI Gene:627Re-query CCDS DB by CCDS ID:7866.1Re-query CCDS DB by GeneID:627See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7866.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000356660.8 ENSP00000349084.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000356660.8Link to Ensembl Protein Viewer:ENSP00000349084.4Re-query CCDS DB by Nucleotide ID:ENST00000356660Re-query CCDS DB by Protein ID:ENSP00000349084
Original member Current member EBI,WTSI ENST00000395978.7 ENSP00000379302.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395978.7Link to Ensembl Protein Viewer:ENSP00000379302.3Re-query CCDS DB by Nucleotide ID:ENST00000395978Re-query CCDS DB by Protein ID:ENSP00000379302
Original member Current member EBI,WTSI ENST00000395980.6 ENSP00000379304.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395980.6Link to Ensembl Protein Viewer:ENSP00000379304.2Re-query CCDS DB by Nucleotide ID:ENST00000395980Re-query CCDS DB by Protein ID:ENSP00000379304
Original member Current member EBI,WTSI ENST00000395981.7 ENSP00000379305.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395981.7Link to Ensembl Protein Viewer:ENSP00000379305.3Re-query CCDS DB by Nucleotide ID:ENST00000395981Re-query CCDS DB by Protein ID:ENSP00000379305
Original member Current member EBI,WTSI ENST00000395983.7 ENSP00000379307.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395983.7Link to Ensembl Protein Viewer:ENSP00000379307.3Re-query CCDS DB by Nucleotide ID:ENST00000395983Re-query CCDS DB by Protein ID:ENSP00000379307
Original member Current member EBI,WTSI ENST00000439476.6 ENSP00000389345.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000439476.6Link to Ensembl Protein Viewer:ENSP00000389345.2Re-query CCDS DB by Nucleotide ID:ENST00000439476Re-query CCDS DB by Protein ID:ENSP00000389345
Original member Current member EBI,WTSI ENST00000420794.2 ENSP00000389564.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000420794.2Link to Ensembl Protein Viewer:ENSP00000389564.1Re-query CCDS DB by Nucleotide ID:ENST00000420794Re-query CCDS DB by Protein ID:ENSP00000389564
Original member Current member EBI,WTSI ENST00000418212.5 ENSP00000400502.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000418212.5Link to Ensembl Protein Viewer:ENSP00000400502.1Re-query CCDS DB by Nucleotide ID:ENST00000418212Re-query CCDS DB by Protein ID:ENSP00000400502
Original member Current member EBI,WTSI ENST00000525950.5 ENSP00000432035.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000525950.5Link to Ensembl Protein Viewer:ENSP00000432035.1Re-query CCDS DB by Nucleotide ID:ENST00000525950Re-query CCDS DB by Protein ID:ENSP00000432035
Original member Current member EBI,WTSI ENST00000533246.5 ENSP00000432376.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000533246.5Link to Ensembl Protein Viewer:ENSP00000432376.1Re-query CCDS DB by Nucleotide ID:ENST00000533246Re-query CCDS DB by Protein ID:ENSP00000432376
Original member Current member EBI,WTSI ENST00000533131.5 ENSP00000432727.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000533131.5Link to Ensembl Protein Viewer:ENSP00000432727.1Re-query CCDS DB by Nucleotide ID:ENST00000533131Re-query CCDS DB by Protein ID:ENSP00000432727
Original member Current member EBI,WTSI ENST00000530861.5 ENSP00000435564.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000530861.5Link to Ensembl Protein Viewer:ENSP00000435564.1Re-query CCDS DB by Nucleotide ID:ENST00000530861Re-query CCDS DB by Protein ID:ENSP00000435564
Original member Current member EBI,WTSI ENST00000532997.5 ENSP00000435805.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000532997.5Link to Ensembl Protein Viewer:ENSP00000435805.1Re-query CCDS DB by Nucleotide ID:ENST00000532997Re-query CCDS DB by Protein ID:ENSP00000435805
Original member Current member EBI,WTSI ENST00000525528.1 ENSP00000437138.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000525528.1Link to Ensembl Protein Viewer:ENSP00000437138.1Re-query CCDS DB by Nucleotide ID:ENST00000525528Re-query CCDS DB by Protein ID:ENSP00000437138
Original member Current member NCBI NM_001143805.1 NP_001137277.1 Accepted alive Link to Nucleotide Sequence:NM_001143805.1Link to Protein Sequence:NP_001137277.1Re-query CCDS DB by Nucleotide ID:NM_001143805Re-query CCDS DB by Protein ID:NP_001137277Link to BLAST:NP_001137277.1
Original member Current member NCBI NM_001143806.1 NP_001137278.1 Accepted alive Link to Nucleotide Sequence:NM_001143806.1Link to Protein Sequence:NP_001137278.1Re-query CCDS DB by Nucleotide ID:NM_001143806Re-query CCDS DB by Protein ID:NP_001137278Link to BLAST:NP_001137278.1
Original member Current member NCBI NM_001143807.1 NP_001137279.1 Accepted alive Link to Nucleotide Sequence:NM_001143807.1Link to Protein Sequence:NP_001137279.1Re-query CCDS DB by Nucleotide ID:NM_001143807Re-query CCDS DB by Protein ID:NP_001137279Link to BLAST:NP_001137279.1
Original member Current member NCBI NM_001143808.1 NP_001137280.1 Accepted alive Link to Nucleotide Sequence:NM_001143808.1Link to Protein Sequence:NP_001137280.1Re-query CCDS DB by Nucleotide ID:NM_001143808Re-query CCDS DB by Protein ID:NP_001137280Link to BLAST:NP_001137280.1
Original member Current member NCBI NM_001143811.1 NP_001137283.1 Accepted alive Link to Nucleotide Sequence:NM_001143811.1Link to Protein Sequence:NP_001137283.1Re-query CCDS DB by Nucleotide ID:NM_001143811Re-query CCDS DB by Protein ID:NP_001137283Link to BLAST:NP_001137283.1
Original member Current member NCBI NM_001143812.1 NP_001137284.1 Accepted alive Link to Nucleotide Sequence:NM_001143812.1Link to Protein Sequence:NP_001137284.1Re-query CCDS DB by Nucleotide ID:NM_001143812Re-query CCDS DB by Protein ID:NP_001137284Link to BLAST:NP_001137284.1
Original member Current member NCBI NM_001143813.1 NP_001137285.1 Accepted alive Link to Nucleotide Sequence:NM_001143813.1Link to Protein Sequence:NP_001137285.1Re-query CCDS DB by Nucleotide ID:NM_001143813Re-query CCDS DB by Protein ID:NP_001137285Link to BLAST:NP_001137285.1
Original member Current member NCBI NM_001143814.1 NP_001137286.1 Accepted alive Link to Nucleotide Sequence:NM_001143814.1Link to Protein Sequence:NP_001137286.1Re-query CCDS DB by Nucleotide ID:NM_001143814Re-query CCDS DB by Protein ID:NP_001137286Link to BLAST:NP_001137286.1
Original member Current member NCBI NM_001143816.1 NP_001137288.1 Accepted alive Link to Nucleotide Sequence:NM_001143816.1Link to Protein Sequence:NP_001137288.1Re-query CCDS DB by Nucleotide ID:NM_001143816Re-query CCDS DB by Protein ID:NP_001137288Link to BLAST:NP_001137288.1
Original member NCBI NM_001709.4 NP_001700.2 Updated not alive Link to Nucleotide Sequence:NM_001709.4Link to Protein Sequence:NP_001700.2Re-query CCDS DB by Nucleotide ID:NM_001709Re-query CCDS DB by Protein ID:NP_001700
Current member NCBI NM_001709.5 NP_001700.2 Accepted alive Link to Nucleotide Sequence:NM_001709.5Link to Protein Sequence:NP_001700.2Re-query CCDS DB by Nucleotide ID:NM_001709Re-query CCDS DB by Protein ID:NP_001700Link to BLAST:NP_001700.2
Original member Current member NCBI NM_170732.4 NP_733928.1 Accepted alive Link to Nucleotide Sequence:NM_170732.4Link to Protein Sequence:NP_733928.1Re-query CCDS DB by Nucleotide ID:NM_170732Re-query CCDS DB by Protein ID:NP_733928Link to BLAST:NP_733928.1
Original member Current member NCBI NM_170733.3 NP_733929.1 Accepted alive Link to Nucleotide Sequence:NM_170733.3Link to Protein Sequence:NP_733929.1Re-query CCDS DB by Nucleotide ID:NM_170733Re-query CCDS DB by Protein ID:NP_733929Link to BLAST:NP_733929.1
Original member Current member NCBI NM_170735.5 NP_733931.1 Accepted alive Link to Nucleotide Sequence:NM_170735.5Link to Protein Sequence:NP_733931.1Re-query CCDS DB by Nucleotide ID:NM_170735Re-query CCDS DB by Protein ID:NP_733931Link to BLAST:NP_733931.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001137277.1 247 P23560-1 247 100% 0 0
NP_001137278.1 247 P23560-1 247 100% 0 0
NP_001137279.1 247 P23560-1 247 100% 0 0
NP_001137280.1 247 P23560-1 247 100% 0 0
NP_001137283.1 247 P23560-1 247 100% 0 0
NP_001137284.1 247 P23560-1 247 100% 0 0
NP_001137285.1 247 P23560-1 247 100% 0 0
NP_001137286.1 247 P23560-1 247 100% 0 0
NP_001137288.1 247 P23560-1 247 100% 0 0
NP_001700.2 247 P23560-1 247 100% 0 0
NP_733928.1 247 P23560-1 247 100% 0 0
NP_733929.1 247 P23560-1 247 100% 0 0
NP_733931.1 247 P23560-1 247 100% 0 0

Chromosomal Locations for CCDS 7866.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 27657821 27658564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (744 nt):
ATGACCATCCTTTTCCTTACTATGGTTATTTCATACTTTGGTTGCATGAAGGCTGCCCCCATGAAAGAAG
CA
AACATCCGAGGACAAGGTGGCTTGGCCTACCCAGGTGTGCGGACCCATGGGACTCTGGAGAGCGTGAA
T
GGGCCCAAGGCAGGTTCAAGAGGCTTGACATCATTGGCTGACACTTTCGAACACGTGATAGAAGAGCTG
TTG
GATGAGGACCAGAAAGTTCGGCCCAATGAAGAAAACAATAAGGACGCAGACTTGTACACGTCCAGGG
TG
ATGCTCAGTAGTCAAGTGCCTTTGGAGCCTCCTCTTCTCTTTCTGCTGGAGGAATACAAAAATTACCT
A
GATGCTGCAAACATGTCCATGAGGGTCCGGCGCCACTCTGACCCTGCCCGCCGAGGGGAGCTGAGCGTG
TGT
GACAGTATTAGTGAGTGGGTAACGGCGGCAGACAAAAAGACTGCAGTGGACATGTCGGGCGGGACGG
TC
ACAGTCCTTGAAAAGGTCCCTGTATCAAAAGGCCAACTGAAGCAATACTTCTACGAGACCAAGTGCAA
T
CCCATGGGTTACACAAAAGAAGGCTGCAGGGGCATAGACAAAAGGCATTGGAACTCCCAGTGCCGAACT
ACC
CAGTCGTACGTGCGGGCCCTTACCATGGATAGCAAAAAGAGAATTGGCTGGCGATTCATAAGGATAG
AC
ACTTCTTGTGTATGTACATTGACCATTAAAAGGGGAAGATAG


Translation (247 aa):
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEEL
L
DEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSV
C
DSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRT
T
QSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser