NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS7850.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7850.1 Public Homo sapiens 11 NAV2 24 110 108 CCDS HistoryNCBI Gene:89797Re-query CCDS DB by CCDS ID:7850.1Re-query CCDS DB by GeneID:89797See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7850.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000349880.9 ENSP00000309577.6 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000349880.9Link to Ensembl Protein Viewer:ENSP00000309577.6Re-query CCDS DB by Nucleotide ID:ENST00000349880Re-query CCDS DB by Protein ID:ENSP00000309577
Original member Current member NCBI NM_145117.5 NP_660093.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_145117.5Link to Protein Sequence:NP_660093.2Re-query CCDS DB by Nucleotide ID:NM_145117Re-query CCDS DB by Protein ID:NP_660093Link to BLAST:NP_660093.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_660093.2 2429 Q8IVL1-3 2429 100% 0 0

Chromosomal Locations for CCDS 7850.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 19713696 19713962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 19832484 19832601 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 19842871 19842923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 19868925 19868997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 19879869 19880127 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 19892434 19892594 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 19933176 19934277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 19939661 19939773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 19946401 19946509 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 19948691 19949080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 19984125 19984247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20035959 20036097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20043981 20044272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20044968 20045670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20048728 20049195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20049836 20049901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20051289 20051333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20054080 20054240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20055769 20055957 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20062307 20062359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20068186 20068209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20068324 20068398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20077552 20077635 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20077993 20078104 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20080064 20080209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20083007 20083179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20090865 20091018 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20092206 20092368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20093099 20093199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20095672 20095767 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20097577 20097745 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20100937 20101172 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20103255 20103409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20103653 20103724 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20105531 20105727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20107664 20107782 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20114592 20114795 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 20118133 20118258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7290 nt):
ATGCCGGCCATCCTGGTCGCCTCCAAAATGAAGTCGGGACTGCCCAAACCCGTGCACAGCGCCGCGCCCA
TC
CTGCACGTGCCCCCGGCCCGGGCGGGCCCCCAGCCCTGCTACCTGAAGTTGGGAAGCAAGGTGGAGGT
G
AGCAAGACCACCTATCCTAGCCAGATCCCCCTGAAATCGCAGGTGCTGCAGGGGCTGCAGGAGCCAGCG
GGG
GAGGGGCTCCCGCTGCGGAAGAGCGGCTCGGTGGAAAACGGGTTCGATACCCAGATCTACACAGACT
GG
GCCAATCATTACCTAGCCAAATCCGGCCACAAGCGTCTCATCAGGGATCTCCAGCAAGATGTGACAGA
T
GGCGTCCTCCTGGCCCAGATTATCCAGGTTGTGGCAAATGAAAAGATTGAAGACATCAATGGCTGTCCG
AAG
AACAGATCCCAAATGATTGAAAACATAGATGCCTGCTTGAATTTCCTGGCAGCTAAGGGAATAAACA
TC
CAGGGGCTGTCTGCAGAAGAGATCAGGAATGGAAACCTCAAGGCCATTCTAGGCCTCTTCTTCAGCCT
C
TCCCGATACAAGCAGCAGCAGCAGCAGCCCCAGAAGCAGCACCTCTCCTCACCTCTGCCGCCCGCCGTA
TCC
CAGGTGGCCGGGGCCCCCTCCCAGTGCCAGGCTGGCACCCCTCAGCAGCAGGTGCCAGTCACTCCCC
AA
GCCCCGTGCCAGCCTCACCAGCCAGCGCCACATCAGCAGTCAAAAGCACAAGCTGAAATGCAGTCCAG
A
CTTCCAGGTCCTACCGCGAGGGTATCCGCTGCAGGCAGCGAGGCCAAAACACGCGGAGGGTCAACTACT
GCT
AACAACCGACGCAGCCAGAGCTTTAACAACTATGATAAATCCAAACCAGTCACCTCCCCACCCCCAC
CG
CCAAGCAGCCACGAGAAAGAGCCTTTGGCAAGTTCAGCCTCCTCCCACCCCGGAATGAGTGACAATGC
A
CCTGCTTCCTTGGAGAGCGGCAGCAGCTCCACCCCTACTAATTGCAGTACCTCCTCGGCCATCCCGCAG
CCC
GGTGCAGCCACCAAGCCTTGGCGCAGCAAATCCCTCAGCGTGAAGCACAGTGCCACGGTATCCATGC
TC
TCGGTCAAGCCTCCTGGGCCTGAGGCCCCCAGGCCCACACCTGAAGCCATGAAGCCGGCCCCCAACAA
T
CAGAAGTCCATGCTGGAAAAGCTGAAACTTTTCAACAGTAAAGGGGGCTCAAAGGCAGGTGAGGGGCCG
GGG
TCCCGGGACACAAGCTGTGAGCGGCTGGAGACTCTGCCCAGCTTCGAAGAGAGCGAGGAGCTGGAGG
CC
GCCAGTCGCATGCTCACCACCGTGGGCCCTGCTTCCAGCAGCCCCAAGATTGCACTCAAGGGCATTGC
C
CAGAGGACTTTTAGCCGGGCACTGACCAACAAGAAGAGTTCTCTGAAAGGCAATGAGAAAGAGAAGGAG
AAA
CAACAGCGGGAGAAGGATAAGGAGAAAAGCAAGGACCTTGCCAAGAGAGCCTCTGTGACGGAGAGGC
TG
GACCTCAAGGAGGAGCCAAAAGAAGACCCCAGTGGAGCAGCTGTGCCCGAGATGCCAAAAAAGTCCTC
C
AAGATTGCCAGCTTCATCCCCAAAGGGGGGAAGCTCAACAGTGCCAAGAAGGAGCCCATGGCCCCTTCC
CAC
AGTGGAATACCAAAACCAGGAATGAAAAGCATGCCCGGGAAATCCCCAAGTGCCCCAGCGCCTTCCA
AG
GAAGGGGAGCGGAGCCGGAGTGGGAAGCTGAGCTCAGGACTCCCCCAGCAGAAGCCCCAGCTGGACGG
C
AGACACTCCAGTTCCTCTTCCAGCCTGGCGTCCTCAGAAGGAAAAGGCCCAGGAGGGACCACCCTGAAC
CAC
AGCATCAGCAGCCAGACTGTCAGTGGGTCTGTCGGGACCACCCAGACCACAGGAAGCAATACCGTCA
GT
GTTCAGCTACCTCAGCCCCAGCAGCAATACAACCATCCCAACACTGCCACGGTTGCACCTTTCCTGTA
C
AGGTCTCAGACGGACACTGAAGGGAATGTTACTGCCGAGTCAAGCTCAACAGGTGTGAGCGTGGAGCCC
AGC
CACTTCACCAAGACTGGACAGCCTGCTCTGGAAGAACTCACTGGGGAAGATCCTGAGGCTCGGCGGC
TG
CGGACAGTGAAGAACATCGCTGATCTGCGGCAGAATTTGGAGGAAACCATGTCCAGTTTAAGGGGAAC
T
CAGGTTACACACAGCACATTGGAAACCACGTTTGACACCAATGTCACCACGGAGATGAGTGGCCGTAGC
ATA
CTCAGCTTGACAGGGAGGCCCACACCTCTGTCCTGGAGACTGGGCCAGTCCAGCCCTCGGCTCCAAG
CA
GGAGACGCCCCCTCAATGGGCAATGGGTATCCCCCTCGAGCCAACGCCAGCAGGTTCATCAACACTGA
G
TCAGGTCGCTATGTGTACTCCGCCCCTCTGAGAAGGCAGCTGGCCTCCCGGGGCAGTAGTGTCTGCCAT
GTG
GACGTCTCAGACAAGGCAGGAGATGAGATGGACCTGGAAGGCATCAGCATGGATGCCCCCGGCTACA
TG
AGCGACGGGGATGTTCTGAGCAAGAACATCCGGACCGATGACATTACAAGCGGATACATGACTGATGG
T
GGACTTGGCCTCTATACCCGTCGCCTGAACCGGCTCCCTGATGGGATGGCTGTGGTACGGGAGACCCTG
CAA
CGAAATACCTCCCTGGGCCTCGGAGACGCTGACAGCTGGGACGACAGCAGCTCCGTCAGCAGCGGCA
TC
AGCGACACCATAGACAACCTCAGCACTGATGACATCAACACCAGCTCCTCCATCAGCTCTTATGCCAA
C
ACACCTGCCTCCTCTCGAAAAAACCTGGATGTGCAGACTGATGCTGAGAAGCACTCACAGGTGGAGAGG
AAT
TCCCTGTGGTCTGGTGATGATGTCAAGAAATCAGACGGAGGCTCAGACAGCGGCATAAAAATGGAGC
CA
GGTTCCAAGTGGAGGCGGAATCCTTCTGATGTGTCTGACGAGTCCGACAAAAGCACGTCGGGCAAGAA
G
AATCCTGTCATCTCCCAGACAGGCTCATGGCGGCGAGGCATGACAGCTCAGGTGGGCATCACCATGCCA
AGG
ACGAAGCCTTCAGCCCCGGCAGGCGCACTGAAGACCCCAGGAACTGGAAAAACAGACGACGCAAAGG
TG
TCTGAGAAAGGAAGGCTTTCTCCTAAAGCCTCCCAGGTGAAGCGCTCCCCATCAGATGCAGGCCGGAG
C
AGTGGTGACGAATCCAAAAAGCCCCTCCCCAGCAGCTCTAGGACACCTACTGCCAATGCCAACAGCTTT
GGG
TTCAAGAAGCAGAGTGGTTCCGCCGCCGGCCTGGCCATGATCACAGCCAGCGGGGTGACTGTCACCA
GC
AGGTCAGCCACACTGGGCAAAATCCCAAAGTCATCTGCACTCGTCAGTCGGTCTGCTGGTCGGAAGTC
A
AGTATGGATGGGGCTCAGAATCAGGATGACGGGTATCTAGCCCTAAGCTCCCGGACAAACCTTCAGTAC
CGG
AGTTTGCCGAGGCCCAGTAAGTCCAACAGCCGGAACGGGGCTGGGAACAGGTCTAGCACCAGCAGCA
TA
GATTCCAACATTAGCAGCAAGTCCGCAGGCCTGCCAGTGCCCAAACTGAGGGAGCCTTCCAAAACAGC
C
CTAGGCAGCTCTCTACCAGGTCTGGTCAACCAAACAGACAAGGAGAAAGGCATCTCATCAGACAACGAG
AGT
GTGGCTTCCTGTAACTCGGTGAAAGTGAATCCGGCAGCCCAGCCTGTGTCCAGTCCGGCTCAGACCA
GT
CTCCAGCCTGGAGCCAAGTACCCAGATGTGGCCTCTCCCACACTCCGCAGACTCTTTGGTGGGAAGCC
T
ACCAAGCAAGTGCCCATCGCCACAGCTGAAAACATGAAAAATTCGGTGGTCATCTCCAATCCTCATGCC
ACC
ATGACTCAGCAAGGTAACCTAGACTCCCCGTCAGGCAGTGGCGTCCTGAGCAGTGGGAGCAGCAGTC
CT
CTCTACAGCAAGAATGTGGACCTCAACCAGTCTCCGCTAGCCTCCAGCCCCAGCTCAGCCCACTCGGC
C
CCTTCCAACAGCCTCACCTGGGGCACCAACGCCAGCAGCTCCTCCGCAGTTAGCAAGGATGGCCTGGGC
TTT
CAGTCTGTCAGCAGCCTCCACACCAGCTGTGAGTCCATCGACATCTCCCTCAGCAGTGGAGGGGTCC
CC
AGCCACAATTCTTCCACTGGCCTCATCGCCTCCTCCAAGGACGACTCCTTGACTCCCTTTGTCAGAAC
T
AACAGTGTGAAGACCACACTGTCAGAAAGCCCTCTCTCTTCCCCTGCTGCTAGCCCTAAGTTCTGCAGA
AGT
ACTCTGCCCAGGAAACAGGACAGTGACCCGCACCTTGATAGGAACACTTTGCCTAAGAAAGGACTCA
G
G
TATACTCCCACCTCCCAGCTTCGCACGCAAGAAGATGCAAAAGAATGGTTACGGTCCCATTCTGCAGG
A
GGCCTTCAGGACACCGCTGCCAATTCCCCCTTTTCCTCTGGCTCCAGCGTGACTTCTCCCTCCGGAACA
AGA
TTCAACTTTTCCCAGCTTGCGAGTCCCACCACTGTCACCCAGATGAGCTTGTCCAACCCGACCATGC
TG
AGGACTCACAGCCTCTCCAATGCTGATGGGCAGTATGATCCATACACTGACAGCCGCTTCCGGAATAG
C
TCCATGTCCCTGGATGAGAAGAGCAGAACCATGAGCCGTTCAGGCTCATTCCGGGATGGGTTTGAAGAA
G
TT
CATGGATCCTCACTCTCCTTGGTTTCCAGCACATCGTCAGTTTATTCTACACCAGAAGAAAAATGCC
AG
TCAGAGATTCGCAAGCTGCGGCGGGAACTGGATGCCTCCCAGGAGAAAGTTTCAGCTTTGACCACCCA
G
CTGACAGCAAATGCTCACCTTGTGGCAGCCTTTGAACAGAGTCTTGGTAACATGACAATCAGGCTCCAG
AGT
CTGACCATGACAGCTGAGCAGAAGGACTCAGAACTGAATGAGTTAAGAAAAACCATTGAGCTGCTAA
AG
AAACAGAACGCAGCTGCCCAGGCTGCCATTAATGGAGTAATTAACACACCTGAGCTCAACTGCAAAGG
A
AACGGCACTGCCCAGTCTGCAGACCTCCGCATCCGCAGGCAGCACTCCTCAGACAGCGTCTCCAGCATC
AAC
AGTGCCACCAGCCACTCCAGCGTGGGCAGCAACATAGAGAGTGACTCAAAGAAGAAGAAGCGGAAGA
AC
TGGTTACGCAGCTCCTTCAAGCAAGCTTTCGGGAAGAAGAAGTCCCCAAAATCTGCGTCCTCTCATTC
A
GATATTGAGGAGATGACGGATTCTTCTTTGCCTTCCTCACCAAAGTTACCGCACAATGGGTCCACAGGT
TCC
ACCCCACTGCTGAGGAATTCTCACTCCAACTCTCTAATTTCAGAATGCATGGATAGTGAAGCTGAGA
CC
GTCATGCAGCTCCGAAATGAGTTAAGAGACAAGGAGATGAAGCTGACGGATATCCGCTTAGAAGCTCT
C
AGTTCTGCCCACCAGCTGGACCAGCTCCGGGAGGCCATGAACAGGATGCAGAGTGAAATAGAGAAGCTG
AAA
GCTGAGAATGATCGGCTGAAGTCAGAGTCTCAAGGCAGTGGCTGCAGCCGGGCTCCTTCCCAAGTGT
CC
ATCTCTGCCTCCCCGAGGCAGTCCATGGGCCTCTCCCAGCACAGCTTGAACCTCACTGAGTCAACCAG
C
CTGGACATGTTGCTGGATGACACTGGTGAATGCTCGGCTCGGAAGGAAGGAGGCAGGCATGTTAAGATA
GTT
GTCAGCTTTCAGGAGGAAATGAAGTGGAAGGAGGATTCCAGACCACATCTCTTTCTTATTGGCTGCA
TT
GGAGTTAGTGGCAAGACGAAGTGGGATGTGCTCGATGGGGTGGTTAGACGGCTGTTCAAAGAATACAT
C
ATTCATGTCGACCCAGTGAGTCAGCTAGGGCTGAATTCAGACAGCGTTCTTGGCTACAGCATTGGAGAA
ATC
AAGCGCAGCAACACTTCCGAAACACCGGAGCTGCTTCCTTGTGGCTATCTGGTTGGAGAGAACACGA
CC
ATCTCAGTGACTGTGAAAGGGCTCGCAGAAAACAGCCTGGACTCACTGGTGTTTGAGTCCTTGATTCC
C
AAGCCCATCCTGCAGCGCTACGTCTCCCTCCTGATAGAGCACCGTCGGATCATTCTCTCTGGCCCCAGC
GGC
ACTGGGAAAACCTACCTGGCCAACCGGCTGTCTGAGTATATAGTGCTTCGAGAGGGACGGGAGTTGA
CA
GACGGGGTTATCGCCACCTTTAACGTGGACCATAAGTCCAGCAAGGAATTGCGCCAGTACCTGTCCAA
C
CTTGCTGACCAGTGCAACAGTGAGAACAATGCTGTGGACATGCCCCTCGTCATCATCCTGGACAACCTA
CAC
CACGTGAGCTCTCTGGGAGAGATCTTCAATGGGCTGCTCAACTGCAAGTACCACAAATGCCCTTACA
TA
ATTGGCACAATGAACCAGGCTACCTCTTCGACTCCCAACCTGCAGCTTCACCATAACTTCAGATGGGT
G
CTTTGTGCCAACCACACGGAGCCTGTGAAGGGTTTCCTTGGCCGATTCCTGAGGAGGAAGCTCATGGAA
ACA
GAGATCAGTGGGCGGGTGCGCAATATGGAGCTGGTAAAAATCATTGACTGGATTCCCAAGGTCTGGC
AT
CACCTCAACCGCTTCCTGGAGGCTCACAGTTCCTCGGACGTCACCATCGGCCCCCGGCTCTTCCTGTC
A
TGCCCCATCGATGTGGACGGCTCGAGAGTGTGGTTCACCGACTTGTGGAACTATTCCATTATCCCCTAT
CTC
CTGGAAGCCGTCAGAGAAGGACTCCAGCTCTATGGAAGGCGCGCCCCCTGGGAGGATCCTGCCAAGT
GG
GTGATGGACACATATCCATGGGCAGCCAGCCCACAACAGCACGAGTGGCCTCCCCTGCTGCAGTTACG
G
CCTGAGGATGTCGGCTTCGACGGCTACTCCATGCCTCGGGAGGGATCGACAAGCAAGCAGATGCCCCCC
AGT
GATGCTGAAGGTGACCCGCTGATGAACATGCTGATGAGGCTGCAGGAGGCAGCCAACTACTCCAGCC
CC
CAGAGCTATGACAGCGACTCCAACAGCAACAGCCATCACGATGACATCTTGGACTCCTCTTTGGAGTC
C
ACTCTGTGA


Translation (2429 aa):
MPAILVASKMKSGLPKPVHSAAPILHVPPARAGPQPCYLKLGSKVEVSKTTYPSQIPLKSQVLQGLQEPA
G
EGLPLRKSGSVENGFDTQ
IYTDWANHYLAKSGHKRLIRDLQQDVTDGVLLAQIIQVVANEKIEDINGCP
K
NRSQM
IENIDACLNFLAAKGINIQGLSAEEIRNGNLKAILGLFFSLSRYKQQQQQPQKQHLSSPLPPAV
S
QVAGAPSQCQAGTPQQQVPVTPQAPCQPHQPAPHQQSKAQAEMQS
RLPGPTARVSAAGSEAKTRGGSTT
A
NNRRSQSFNNYDKSKPVTSPPPPPSSHEK
EPLASSASSHPGMSDNAPASLESGSSSTPTNCSTSSAIPQ
P
GAATKPWRSKSLSVKHSATVSMLSVKPPGPEAPRPTPEAMKPAPNNQKSMLEKLKLFNSKGGSKAGEGP
G
SRDTSCERLETLPSFEESEELEAASRMLTTVGPASSSPKIALKGIAQRTFSRALTNKKSSLKGNEKEKE
K
QQREKDKEKSKDLAKRASVTERLDLKEEPKEDPSGAAVPEMPKKSSKIASFIPKGGKLNSAKKEPMAPS
H
SGIPKPGMKSMPGKSPSAPAPSKEGERSRSGKLSSGLPQQKPQLDGRHSSSSSSLASSEGKGPGGTTLN
H
SISSQTVSGSVGTTQTTGSNTVSVQLPQPQQQYNHPNTATVAPFLY
RSQTDTEGNVTAESSSTGVSVEP
S
HFTKTGQPALEELT
GEDPEARRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETTFDTNVTTEMSGRS
I
LSLTGRPTPLSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFINTESGRYVYSAPLRRQLASRGSSVCH
V
DVSDKAGDEMDLEGISMDAPGYMSDGDVLSKNIRTDDITS
GYMTDGGLGLYTRRLNRLPDGMAVVRETL
Q
RNTSLGLGDAD
SWDDSSSVSSGISDTIDNLSTDDINTSSSISSYANTPASSRKNLDVQTDAEKHSQVER
N
SLWSGDDVKKSDGGSDSGIKMEPGSKWRRNPSDVSDESDKSTSGKKNPVISQTGSWRRGMTAQVGITMP
R
TKPSAPAGALKTPGT
GKTDDAKVSEKGRLSPKASQVKRSPSDAGRSSGDESKKPLPSSSRTPTANANSF
G
FKKQSGSAAGLAMITASGVTVTSRSATLGKIPKSSALVSRSAGRKSSMDGAQNQDDGYLALSSRTNLQY
R
SLPRPSKSNSRNGAGNRSSTSSIDSNISSKSAGLPVPKLREPSKTALGSSLPGLVNQTDKEKGISSDNE
S
VASCNSVKVNPAAQPVSSPAQTSLQPGAKYPDVASPTLR
RLFGGKPTKQVPIATAENMKNSVVISNPHA
T
MTQQGNLDSPSGSGVLSSGSSSPLYSKNVDLNQSPLASSPSSAHSAPSNSLTWGTNASSSSAVSKDGLG
F
QSVSSLHTSCESIDISLSSGGVPSHNSSTGLIASSKDDSLTPFVRTNSVKTTLSE
SPLSSPAASPKFCR
S
TLPRKQD
SDPHLDRNTLPKKGLRYTPTSQLRTQEDAKEWLRSHSAGGLQDTAANSPFSSGSSVTSPSGT
R
FNFSQL
ASPTTVTQMSLSNPTMLRTHSLSNADGQYDPYTDSRFRNSSMSLDEKSRTMSRSGSFRDGFEE
V
HGSSLSLVSSTSSVYSTPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQ
S
LTMTAEQK
DSELNELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGTAQSADLRIRRQHSSDSVSSI
N
SATSHSSVGSNIESDSKKKKRKNW
LRSSFKQAFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPHNGSTG
S
TPLLRNSHSNS
LISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKL
K
AENDRLKSESQGSGCSRAPSQVSISASPRQSMGLSQHSLNLTESTSL
DMLLDDTGECSARKEGGRHVKI
V
VSFQEEMKWKE
DSRPHLFLIGCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNSDSVLGYSIGE
I
KRSNTSETPELLPCGYLVGENTTISVTVK
GLAENSLDSLVFESLIPKPILQRYVSLLIEHRRIILSGPS
G
TGKTYLANRLSEYIVLREGRELTDGVIATFNVDHKSSK
ELRQYLSNLADQCNSENNAVDMPLVIILDNL
H
HVSSLGEIFNGLLNCKYHK
CPYIIGTMNQATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRFLRRKLME
T
EISGRVRNMELVKIIDWIPKVWHHLNRFLEAHSSSDVTI
GPRLFLSCPIDVDGSRVWFTDLWNYSIIPY
L
LEAVREGLQ
LYGRRAPWEDPAKWVMDTYPWAASPQQHEWPPLLQLRPEDVGFDGYSMPREGSTSKQMPP
S
DAEGDPL
MNMLMRLQEAANYSSPQSYDSDSNSNSHHDDILDSSLESTL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser