NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS7817.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7817.1 Public Homo sapiens 11 PDE3B 22 109 92 CCDS HistoryNCBI Gene:5140Re-query CCDS DB by CCDS ID:7817.1Re-query CCDS DB by GeneID:5140See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7817.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000282096.8 ENSP00000282096.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000282096.8Link to Ensembl Protein Viewer:ENSP00000282096.4Re-query CCDS DB by Nucleotide ID:ENST00000282096Re-query CCDS DB by Protein ID:ENSP00000282096
Original member NCBI NM_000922.3 NP_000913.2 Updated not alive Link to Nucleotide Sequence:NM_000922.3Link to Protein Sequence:NP_000913.2Re-query CCDS DB by Nucleotide ID:NM_000922Re-query CCDS DB by Protein ID:NP_000913
Current member NCBI NM_000922.4 NP_000913.2 Accepted alive Link to Nucleotide Sequence:NM_000922.4Link to Protein Sequence:NP_000913.2Re-query CCDS DB by Nucleotide ID:NM_000922Re-query CCDS DB by Protein ID:NP_000913Link to BLAST:NP_000913.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000913.2 1112 Q13370-1 1112 100% 0 0

Chromosomal Locations for CCDS 7817.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 14644076 14645053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14771937 14771987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14786437 14786685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14789106 14789242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14803944 14804050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14818183 14818393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14819136 14819209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14830698 14830846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14831640 14831777 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14832722 14832833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14834982 14835095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14843827 14844026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14859043 14859246 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14861205 14861366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14867506 14867758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 14869461 14869660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3339 nt):
ATGAGGAGGGACGAGCGAGACGCCAAAGCCATGCGGTCCCTGCAGCCGCCGGATGGGGCCGGCTCGCCCC
CC
GAGAGTCTGAGGAACGGCTACGTGAAGAGCTGCGTGAGCCCCTTGCGGCAGGACCCTCCGCGCGGCTT
C
TTCTTCCACCTCTGCCGCTTCTGCAACGTGGAGCTGCGGCCGCCGCCGGCCTCTCCCCAGCAGCCGCGG
CGC
TGCTCCCCCTTCTGCCGGGCGCGCCTCTCGCTGGGCGCCCTGGCTGCCTTTGTCCTCGCCCTGCTGC
TG
GGCGCGGAACCCGAGAGCTGGGCTGCCGGGGCCGCCTGGCTGCGGACGCTGCTGAGCGTGTGTTCGCA
C
AGCTTGAGCCCCCTCTTCAGCATCGCCTGTGCCTTCTTCTTCCTCACCTGCTTCCTCACCCGGACCAAG
CGG
GGACCCGGCCCGGGCCGGAGCTGCGGCTCCTGGTGGCTGCTGGCGCTGCCCGCCTGCTGTTACCTGG
GG
GACTTCTTGGTGTGGCAGTGGTGGTCTTGGCCTTGGGGGGATGGCGACGCAGGGTCCGCGGCCCCGCA
C
ACGCCCCCGGAGGCGGCAGCGGGCAGGTTGCTGCTGGTGCTGAGCTGCGTAGGGCTGCTGCTGACGCTC
GCG
CACCCGCTGCGGCTCCGGCACTGCGTTCTGGTGCTGCTCCTGGCCAGCTTCGTCTGGTGGGTCTCCT
TC
ACCAGCCTCGGGTCGCTGCCCTCCGCCCTCAGGCCGCTGCTCTCCGGCCTGGTGGGGGGCGCTGGCTG
C
CTGCTGGCCCTGGGGTTGGATCACTTCTTTCAAATCAGGGAAGCGCCTCTTCATCCTCGACTGTCCAGT
GCC
GCCGAAGAAAAAGTGCCTGTGATCCGACCCCGGAGGAGGTCCAGCTGCGTGTCGTTAGGAGAAACTG
CA
GCCAGTTACTATGGCAGTTGCAAAATATTCAGGAGACCGTCGTTGCCTTGTATTTCCAGAGAACAGAT
G
ATTCTTTGGGATTGGGACTTAAAACAATGGTATAAGCCTCATTATCAAAATTCTGGAGGTGGAAATGGA
GTT
GATCTTTCAGTGCTAAATGAGGCTCGCAATATGGTGTCAGATCTTCTGACTGATCCAAGCCTTCCAC
CA
CAAGTCATTTCCTCTCTACGGAGTATTAGTAGCTTAATGGGTGCTTTCTCAGGTTCCTGTAGGCCAAA
G
ATTAATCCTCTCACACCATTTCCTGGATTTTACCCCTGTTCTGAAATAGAGGACCCAGCTGAGAAAGGG
GAT
AGAAAACTTAACAAGGGACTAAATAGGAATAGTTTGCCAACTCCACAGCTGAGGAGAAGCTCAGGAA
CT
TCAGGATTGCTACCTGTTGAACAGTCTTCAAGGTGGGATCGTAATAATGGCAAAAGACCTCACCAAGA
A
TTTGGCATTTCAAGTCAAGGATGCTATCTAAATGGGCCTTTTAATTCAAATCTACTGACTATCCCGAAG
CAA
AGGTCATCTTCTGTATCACTGACTCACCATGTAGGTCTCAGAAGAGCTGGTGTTTTGTCCAGTCTGA
GT
CCTGTGAATTCTTCCAACCATGGACCAGTGTCTACTGGCTCTCTAACTAATCGATCACCCATAGAATT
T
CCTGATACTGCTGATTTTCTTAATAAGCCAAGCGTTATCTTGCAGAGATCTCTGGGCAATGCACCTAAT
ACT
CCAGATTTTTATCAGCAACTTAGAAATTCTGATAGCAATCTGTGTAACAGCTGTGGACATCAAATGC
TG
AAATATGTTTCAACATCTGAATCAGATGGTACAGATTGCTGCAGTGGAAAATCAGGTGAAGAAGAAAA
C
ATTTTCTCGAAAGAATCATTCAAACTTATGGAAACTCAACAAGAAGAGGAAACAGAGAAGAAAGACAGC
AGA
AAATTATTTCAGGAAGGTGATAAGTGGCTAACAGAAGAGGCACAGAGTGAACAGCAAACAAATATTG
AA
CAGGAAGTATCACTGGACCTGATTTTAGTAGAAGAGTATGACTCATTAATAGAAAAGATGAGCAACTG
G
AATTTTCCAATTTTTGAACTTGTAGAAAAGATGGGAGAGAAATCAGGAAGGATTCTCAGTCAGGTTATG
TAT
ACCTTATTTCAAGACACTGGTTTATTGGAAATATTTAAAATTCCCACTCAACAATTTATGAACTATT
TT
CGTGCATTAGAAAATGGCTATCGAGACATTCCTTATCACAATCGTATACATGCCACAGATGTGCTACA
T
GCAGTTTGGTATCTGACAACACGGCCAGTTCCTGGCTTACAGCAGATCCACAATGGTTGTGGAACAGGA
AAT
GAAACAGATTCTGATGGTAGAATTAACCATGGGCGAATTGCTTATATTTCTTCGAAGAGCTGCTCTA
AT
CCTGATGAGAGTTATGGCTGCCTGTCTTCAAACATTCCTGCATTAGAATTGATGGCTCTATACGTGGC
A
GCTGCCATGCATGATTATGATCACCCAGGGAGGACAAATGCATTTCTAGTGGCTACAAATGCCCCTCAG
GCA
GTTTTATACAATGACAGATCTGTTCTGGAAAATCATCATGCTGCGTCAGCTTGGAATCTATATCTTT
CT
CGCCCAGAATACAACTTCCTTCTTCATCTTGATCATGTGGAATTCAAGCGCTTTCGTTTTTTAGTCAT
T
GAAGCAATCCTTGCTACGGATCTTAAAAAGCATTTTGATTTTCTCGCAGAATTCAATGCCAAGGCAAAT
GAT
GTAAATAGTAATGGCATAGAATGGAGTAATGAAAATGATCGCCTCTTGGTATGCCAGGTGTGCATCA
AA
CTGGCAGATATAAATGGCCCAGCAAAAGTTCGAGACTTGCATTTGAAATGGACAGAAGGCATTGTCAA
T
GAATTTTATGAGCAGGGAGATGAAGAAGCAAATCTTGGTCTGCCCATCAGTCCATTCATGGATCGTTCT
TCT
CCTCAACTAGCAAAACTCCAAGAATCTTTTATCACCCACATAGTGGGTCCCCTGTGTAACTCCTATG
AT
GCTGCTGGTTTGCTACCAGGTCAGTGGTTAGAAGCAGAAGAGGATAATGATACTGAAAGTGGTGATGA
T
GAAGACGGTGAAGAATTAGATACAGAAGATGAAGAAATGGAAAACAATCTAAATCCAAAACCACCAAGA
AGG
AAAAGCAGACGGCGAATATTTTGTCAGCTAATGCACCACCTCACTGAAAACCACAAGATATGGAAGG
AA
ATCGTAGAGGAAGAAGAAAAATGTAAAGCTGATGGGAATAAACTGCAGGTGGAGAATTCCTCCTTACC
T
CAAGCAGATGAGATTCAGGTAATTGAAGAGGCAGATGAAGAGGAATAG


Translation (1112 aa):
MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELRPPPASPQQPR
R
CSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLSPLFSIACAFFFLTCFLTRTK
R
GPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGDAGSAAPHTPPEAAAGRLLLVLSCVGLLLTL
A
HPLRLRHCVLVLLLASFVWWVSFTSLGSLPSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSS
A
AEEKVPVIRPRRRSSCVSLGETAASYYGSCKIFRRPSLPCISREQ
MILWDWDLKQWYKPHYQNSGGGNG
V
DLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG
D
RKLNK
GLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPK
Q
RSSSVSLTHHVGLRRA
GVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPN
T
PDFYQQLRNSDSNLCN
SCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDS
R
KLFQEGDKWLTEEAQSEQQTN
IEQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVM
Y
TLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIP
YHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTG
N
ET
DSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
A
VLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAK
AN
D
VNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQ
GDEEANLGLPISPFMDRS
S
PQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNP
KPPR
R
KSRRRIFCQLMHHLTENHKIWKEIVEEEEKCKADGNKLQVENSSLPQADEIQVIEEADEEE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser