NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS78052.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
78052.1 Public Homo sapiens 5 HSD17B4 22 109 92 CCDS HistoryNCBI Gene:3295Re-query CCDS DB by CCDS ID:78052.1Re-query CCDS DB by GeneID:3295See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 18, NCBI annotation release 107, Ensembl annotation release 79

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 78052.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000646646.1 ENSP00000493642.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000646646.1Link to Ensembl Protein Viewer:ENSP00000493642.1Re-query CCDS DB by Nucleotide ID:ENST00000646646Re-query CCDS DB by Protein ID:ENSP00000493642
Original member NCBI NM_001292028.1 NP_001278957.1 Updated not alive Link to Nucleotide Sequence:NM_001292028.1Link to Protein Sequence:NP_001278957.1Re-query CCDS DB by Nucleotide ID:NM_001292028Re-query CCDS DB by Protein ID:NP_001278957
Current member NCBI NM_001292028.2 NP_001278957.1 Accepted alive Link to Nucleotide Sequence:NM_001292028.2Link to Protein Sequence:NP_001278957.1Re-query CCDS DB by Nucleotide ID:NM_001292028Re-query CCDS DB by Protein ID:NP_001278957Link to BLAST:NP_001278957.1

Chromosomal Locations for CCDS 78052.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 119477479 119477492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119478834 119479021 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119489192 119489283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119492100 119492124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119493818 119493946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119496543 119496646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119499317 119499553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119502041 119502092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119506818 119506889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119509141 119509244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119514981 119515046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119525216 119525285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119525917 119526023 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119527133 119527219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119529894 119529980 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119531266 119531404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119536423 119536550 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119541905 119541994 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1791 nt):
ATGAAGAAACAGAAGATTATTATGACTTCATCAGCTTCAGGAATATATGGCAACTTTGGCCAGGCCAATT
AT
AGTGCTGCAAAGTTGGGTCTTCTGGGCCTTGCAAATTCTCTTGCAATTGAAGGCAGGAAAAGCAACAT
T
CATTGTAACACCATTGCTCCTAATGCGGGATCACGGATGACTCAGACAGTTATGCCTGAAGATCTTGTG
GAA
GCCCTGAAGCCAGAGTATGTGGCACCTCTTGTCCTTTGGCTTTGTCACGAGAGTTGTGAGGAGAATG
GT
GGCTTGTTTGAGGTTGGAGCAGGATGGATTGGAAAATTACGCTGGGAGCGGACTCTTGGAGCTATTGT
A
AGACAAAAGAATCACCCAATGACTCCTGAGGCAGTCAAGGCTAACTGGAAGAAGATCTGTGACTTTGAG
AAT
GCCAGCAAGCCTCAGAGTATCCAAGAATCAACTGGCAGTATAATTGAAGTTCTGAGTAAAATAGATT
CA
GAAGGAGGAGTTTCAGCAAATCATACTAGTCGTGCAACGTCTACAGCAACATCAGGATTTGCTGGAGC
T
ATTGGCCAGAAACTCCCTCCATTTTCTTATGCTTATACGGAACTGGAAGCTATTATGTATGCCCTTGGA
GTG
GGAGCGTCAATCAAGGATCCAAAAGATTTGAAATTTATTTATGAAGGAAGTTCTGATTTCTCCTGTT
TG
CCCACCTTCGGAGTTATCATAGGTCAGAAATCTATGATGGGTGGAGGATTAGCAGAAATTCCTGGACT
T
TCAATCAACTTTGCAAAGGTTCTTCATGGAGAGCAGTACTTAGAGTTATATAAACCACTTCCCAGAGCA
G
GA
AAATTAAAATGTGAAGCAGTTGTTGCTGATGTCCTAGATAAAGGATCCGGTGTAGTGATTATTATGG
AT
GTCTATTCTTATTCTGAGAAGGAACTTATATGCCACAATCAGTTCTCTCTCTTTCTTGTTGGCTCTGG
A
GGCTTTGGTGGAAAACGGACATCAGACAAAGTCAAGGTAGCTGTAGCCATACCTAATAGACCTCCTGAT
GCT
GTACTTACAGATACCACCTCTCTTAATCAGGCTGCTTTGTACCGCCTCAGTGGAGACTGGAATCCCT
TA
CACATTGATCCTAACTTTGCTAGTCTAGCAGGTTTTGACAAGCCCATATTACATGGATTATGTACATT
T
GGATTTTCTGCCAGGCGTGTGTTACAGCAGTTTGCAGATAATGATGTGTCAAGATTCAAGGCAATTAAG
GCT
CGTTTTGCAAAACCAGTATATCCAGGACAAACTCTACAAACTGAGATGTGGAAGGAAGGAAACAGAA
TT
CATTTTCAAACCAAGGTCCAAGAAACTGGAGACATTGTCATTTCAAATGCATATGTGGATCTTGCACC
A
ACATCTGGTACTTCAGCTAAGACACCCTCTGAGGGCGGGAAGCTTCAGAGTACCTTTGTATTTGAGGAA
ATA
GGACGCCGCCTAAAGGATATTGGGCCTGAGGTGGTGAAGAAAGTAAATGCTGTATTTGAGTGGCATA
TA
ACCAAAGGCGGAAATATTGGGGCTAAGTGGACTATTGACCTGAAAAGTGGTTCTGGAAAAGTGTACCA
A
GGCCCTGCAAAAGGTGCTGCTGATACAACAATCATACTTTCAGATGAAGATTTCATGGAGGTGGTCCTG
GGC
AAGCTTGACCCTCAGAAGGCATTCTTTAGTGGCAGGCTGAAGGCCAGAGGGAACATCATGCTGAGCC
AG
AAACTTCAGATGATTCTTAAAGACTACGCCAAGCTCTGA


Translation (596 aa):
MKKQKIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLV
E
ALKPEYVAPLVLWLCHESCEENGGLFE
VGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFE
N
ASKPQSIQ
ESTGSIIEVLSKIDSEGGVSANHTSRATSTATSGFAGAIGQKLPPFSYAYTELEAIMYALG
V
GASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQKSMMGGGLAEIPGLSINFAK
VLHGEQYLELYKPLPRA
G
KLKCEAVVADVLDKGSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPD
A
VLTDTTSLNQ
AALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIK
A
RFAKPVYPGQTLQTEMWKEGNRIHFQTK
VQETGDIVISNAYVDLAPTSGTSAKTPSEGGKLQSTFVFEE
I
GRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKW
TIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVL
G
KLDPQK
AFFSGRLKARGNIMLSQKLQMILKDYAKL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser