NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, May 21, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS7768.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7768.1 Public Homo sapiens 11 ILK 24 110 108 CCDS HistoryNCBI Gene:3611Re-query CCDS DB by CCDS ID:7768.1Re-query CCDS DB by GeneID:3611See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7768.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000299421.9 ENSP00000299421.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000299421.9Link to Ensembl Protein Viewer:ENSP00000299421.4Re-query CCDS DB by Nucleotide ID:ENST00000299421Re-query CCDS DB by Protein ID:ENSP00000299421
Original member Current member EBI ENST00000396751.6 ENSP00000379975.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000396751.6Link to Ensembl Protein Viewer:ENSP00000379975.2Re-query CCDS DB by Nucleotide ID:ENST00000396751Re-query CCDS DB by Protein ID:ENSP00000379975
Original member Current member EBI ENST00000420936.6 ENSP00000403487.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000420936.6Link to Ensembl Protein Viewer:ENSP00000403487.2Re-query CCDS DB by Nucleotide ID:ENST00000420936Re-query CCDS DB by Protein ID:ENSP00000403487
Original member Current member NCBI NM_001014794.3 NP_001014794.1 Accepted alive Link to Nucleotide Sequence:NM_001014794.3Link to Protein Sequence:NP_001014794.1Re-query CCDS DB by Nucleotide ID:NM_001014794Re-query CCDS DB by Protein ID:NP_001014794Link to BLAST:NP_001014794.1
Original member Current member NCBI NM_001014795.3 NP_001014795.1 Accepted alive Link to Nucleotide Sequence:NM_001014795.3Link to Protein Sequence:NP_001014795.1Re-query CCDS DB by Nucleotide ID:NM_001014795Re-query CCDS DB by Protein ID:NP_001014795Link to BLAST:NP_001014795.1
Original member Current member NCBI NM_004517.4 NP_004508.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_004517.4Link to Protein Sequence:NP_004508.1Re-query CCDS DB by Nucleotide ID:NM_004517Re-query CCDS DB by Protein ID:NP_004508Link to BLAST:NP_004508.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001014794.1 452 Q13418-1 452 100% 0 0
NP_001014795.1 452 Q13418-1 452 100% 0 0
NP_004508.1 452 Q13418-1 452 100% 0 0

Chromosomal Locations for CCDS 7768.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 6604272 6604360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6608046 6608211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6608394 6608489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6608694 6608790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6608884 6608967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6609071 6609156 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6609299 6609408 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6609512 6609639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6609724 6609845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6609936 6610035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6610148 6610278 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6610462 6610611 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1359 nt):
ATGGACGACATTTTCACTCAGTGCCGGGAGGGCAACGCAGTCGCCGTTCGCCTGTGGCTGGACAACACGG
AG
AACGACCTCAACCAGGGGGACGATCATGGCTTCTCCCCCTTGCACTGGGCCTGCCGAGAGGGCCGCTC
T
GCTGTGGTTGAGATGTTGATCATGCGGGGGGCACGGATCAATGTAATGAACCGTGGGGATGACACCCCC
CTG
CATCTGGCAGCCAGTCATGGACACCGTGATATTGTACAGAAGCTATTGCAGTACAAGGCAGACATCA
AT
GCAGTGAATGAACACGGGAATGTGCCCCTGCACTATGCCTGTTTTTGGGGCCAAGATCAAGTGGCAGA
G
GACCTGGTGGCAAATGGGGCCCTTGTCAGCATCTGTAACAAGTATGGAGAGATGCCTGTGGACAAAGCC
AAG
GCACCCCTGAGAGAGCTTCTCCGAGAGCGGGCAGAGAAGATGGGCCAGAATCTCAACCGTATTCCAT
AC
AAGGACACATTCTGGAAGGGGACCACCCGCACTCGGCCCCGAAATGGAACCCTGAACAAACACTCTGG
C
ATTGACTTCAAACAGCTTAACTTCCTGACGAAGCTCAACGAGAATCACTCTGGAGAGCTATGGAAGGGC
CGC
TGGCAGGGCAATGACATTGTCGTGAAGGTGCTGAAGGTTCGAGACTGGAGTACAAGGAAGAGCAGGG
AC
TTCAATGAAGAGTGTCCCCGGCTCAGGATTTTCTCGCATCCAAATGTGCTCCCAGTGCTAGGTGCCTG
C
CAGTCTCCACCTGCTCCTCATCCTACTCTCATCACACACTGGATGCCGTATGGATCCCTCTACAATGTA
CTA
CATGAAGGCACCAATTTCGTCGTGGACCAGAGCCAGGCTGTGAAGTTTGCTTTGGACATGGCAAGGG
GC
ATGGCCTTCCTACACACACTAGAGCCCCTCATCCCACGACATGCACTCAATAGCCGTAGTGTAATGAT
T
GATGAGGACATGACTGCCCGAATTAGCATGGCTGATGTCAAGTTCTCTTTCCAATGTCCTGGTCGCATG
TAT
GCACCTGCCTGGGTAGCCCCCGAAGCTCTGCAGAAGAAGCCTGAAGACACAAACAGACGCTCAGCAG
AC
ATGTGGAGTTTTGCAGTGCTTCTGTGGGAACTGGTGACACGGGAGGTACCCTTTGCTGACCTCTCCAA
T
ATGGAGATTGGAATGAAGGTGGCATTGGAAGGCCTTCGGCCTACCATCCCACCAGGTATTTCCCCTCAT
GTG
TGTAAGCTCATGAAGATCTGCATGAATGAAGACCCTGCAAAGCGACCCAAATTTGACATGATTGTGC
CT
ATCCTTGAGAAGATGCAGGACAAGTAG


Translation (452 aa):
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTP
L
HLAASHGHRDIVQK
LLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKA
K
APLRELLR
ERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKG
R
WQGNDIVVKVLKVRDWSTRKSRDFNEECPRL
RIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNV
L
HEGT
NFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRM
Y
APAWVAPE
ALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
V
CKLMKICMNEDPAKRPKFDMIVPILEKMQDK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser