NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS7763.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7763.1 Public Homo sapiens 11 HPX 22 109 92 CCDS HistoryNCBI Gene:3263Re-query CCDS DB by CCDS ID:7763.1Re-query CCDS DB by GeneID:3263See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7763.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000265983.7 ENSP00000265983.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000265983.7Link to Ensembl Protein Viewer:ENSP00000265983.3Re-query CCDS DB by Nucleotide ID:ENST00000265983Re-query CCDS DB by Protein ID:ENSP00000265983
Original member NCBI NM_000613.2 NP_000604.1 Updated not alive Link to Nucleotide Sequence:NM_000613.2Link to Protein Sequence:NP_000604.1Re-query CCDS DB by Nucleotide ID:NM_000613Re-query CCDS DB by Protein ID:NP_000604
Current member NCBI NM_000613.3 NP_000604.1 Accepted alive Link to Nucleotide Sequence:NM_000613.3Link to Protein Sequence:NP_000604.1Re-query CCDS DB by Nucleotide ID:NM_000613Re-query CCDS DB by Protein ID:NP_000604Link to BLAST:NP_000604.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000604.1 462 P02790 462 100% 0 0

Chromosomal Locations for CCDS 7763.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 6431211 6431470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6431641 6431803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6431887 6432017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6437046 6437177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6437440 6437652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6438356 6438509 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6440165 6440286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6440467 6440538 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6440672 6440730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 6440881 6440963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1389 nt):
ATGGCTAGGGTACTGGGAGCACCCGTTGCACTGGGGTTGTGGAGCCTATGCTGGTCTCTGGCCATTGCCA
CC
CCTCTTCCTCCGACTAGTGCCCATGGGAATGTTGCTGAAGGCGAGACCAAGCCAGACCCAGACGTGAC
T
GAACGCTGCTCAGATGGCTGGAGCTTTGATGCTACCACCCTGGATGACAATGGAACCATGCTGTTTTTT
AAA
GGGGAGTTTGTGTGGAAGAGTCACAAATGGGACCGGGAGTTAATCTCAGAGAGATGGAAGAATTTCC
CC
AGCCCTGTGGATGCTGCATTCCGTCAAGGTCACAACAGTGTCTTTCTGATCAAGGGGGACAAAGTCTG
G
GTATACCCTCCTGAAAAGAAGGAGAAAGGATACCCAAAGTTGCTCCAAGATGAATTTCCTGGAATCCCA
TCC
CCACTGGATGCAGCTGTGGAATGTCACCGTGGAGAATGTCAAGCTGAAGGCGTCCTCTTCTTCCAAG
GT
GACCGCGAGTGGTTCTGGGACTTGGCTACGGGAACCATGAAGGAGCGTTCCTGGCCAGCTGTTGGGAA
C
TGCTCCTCTGCCCTGAGATGGCTGGGCCGCTACTACTGCTTCCAGGGTAACCAATTCCTGCGCTTCGAC
CCT
GTCAGGGGAGAGGTGCCTCCCAGGTACCCGCGGGATGTCCGAGACTACTTCATGCCCTGCCCTGGCA
GA
GGCCATGGACACAGGAATGGGACTGGCCATGGGAACAGTACCCACCATGGCCCTGAGTATATGCGCTG
T
AGCCCACATCTAGTCTTGTCTGCACTGACGTCTGACAACCATGGTGCCACCTATGCCTTCAGTGGGACC
CAC
TACTGGCGTCTGGACACCAGCCGGGATGGCTGGCATAGCTGGCCCATTGCTCATCAGTGGCCCCAGG
GT
CCTTCAGCAGTGGATGCTGCCTTTTCCTGGGAAGAAAAACTCTATCTGGTCCAGGGCACCCAGGTATA
T
GTCTTCCTGACAAAGGGAGGCTATACCCTAGTAAGCGGTTATCCGAAGCGGCTGGAGAAGGAAGTCGGG
ACC
CCTCATGGGATTATCCTGGACTCTGTGGATGCGGCCTTTATCTGCCCTGGGTCTTCTCGGCTCCATA
TC
ATGGCAGGACGGCGGCTGTGGTGGCTGGACCTGAAGTCAGGAGCCCAAGCCACGTGGACAGAGCTTCC
T
TGGCCCCATGAGAAGGTAGACGGAGCCTTGTGTATGGAAAAGTCCCTTGGCCCTAACTCATGTTCCGCC
AAT
GGTCCCGGCTTGTACCTCATCCATGGTCCCAATTTGTACTGCTACAGTGATGTGGAGAAACTGAATG
CA
GCCAAGGCCCTTCCGCAACCCCAGAATGTGACCAGTCTCCTGGGCTGCACTCACTGA


Translation (462 aa):
MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFF
K
GEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIP
S
PLDAAVECHRGECQAEGVLFFQ
GDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFD
P
VRGEVPPRYPRDVRDYFMPCPGR
GHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGT
H
YWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQ
GTQVYVFLTKGGYTLVSGYPKRLEKEVG
T
PHGIILDSVDAAFICPGSSRLHIMA
GRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSA
N
GPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser